Dbfetch

ID   AF387674; SV 1; linear; genomic DNA; STD; MUS; 3569 BP.
XX
AC   AF387674;
XX
DT   03-JUL-2001 (Rel. 68, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Mus musculus neurexin 1 (Nrxn1) gene, partial cds, alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3569
RA   Graveley B.R., Philipps D.L.;
RT   "Sequencing of the neurexin genes";
RL   Unpublished.
XX
RN   [2]
RP   1-3569
RA   Graveley B.R., Philipps D.L.;
RT   ;
RL   Submitted (31-MAY-2001) to the INSDC.
RL   Genetics and Developmental Biology, University of Connecticut Health
RL   Center, 263 Farmington Avenue, Farmington, CT 06030-3301, USA
XX
DR   MD5; bd0151429182992d40f7b5e75c7d5f2c.
DR   Ensembl-Gn; ENSMUSG00000024109; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024115; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024075; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024044; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024076; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023841; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024521; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023320; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023814; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023943; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023909; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024027; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023937; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024566; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023065; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023386; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000054059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072671; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161402; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197268; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048807; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0048784; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0048744; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048746; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048489; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0049238; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048570; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0048416; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0048518; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0048487; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0048635; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048491; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0049338; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048169; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047792; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3569
FT                   /organism="Mus musculus"
FT                   /strain="CD-1"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(<1..245,2321..2365,3437..>3569)
FT                   /gene="Nrxn1"
FT                   /product="neurexin 1 NRXN1+7b"
FT   mRNA            join(<1..245,2321..2344,3437..>3569)
FT                   /gene="Nrxn1"
FT                   /product="neurexin 1 NRXN1+7a"
FT   mRNA            join(<1..245,3437..>3569)
FT                   /gene="Nrxn1"
FT                   /product="neurexin 1 NRXN1-7"
FT   CDS             join(<1..245,2321..2365,3437..>3569)
FT                   /codon_start=3
FT                   /gene="Nrxn1"
FT                   /product="neurexin 1 NRXN1+7b"
FT                   /db_xref="GOA:Q9CS84"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR003585"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027789"
FT                   /db_xref="InterPro:IPR037440"
FT                   /db_xref="MGI:MGI:1096391"
FT                   /db_xref="PDB:3BOD"
FT                   /db_xref="PDB:3MW2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CS84"
FT                   /protein_id="AAK70469.1"
FT                   /translation="QNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSL
FT                   VINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGI
FT                   LTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPV"
FT   CDS             join(<1..245,2321..2344,3437..>3569)
FT                   /codon_start=3
FT                   /gene="Nrxn1"
FT                   /product="neurexin 1 NRXN1+7a"
FT                   /db_xref="GOA:Q9CS84"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR003585"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027789"
FT                   /db_xref="InterPro:IPR037440"
FT                   /db_xref="MGI:MGI:1096391"
FT                   /db_xref="PDB:3BOD"
FT                   /db_xref="PDB:3MW2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CS84"
FT                   /protein_id="AAK70470.1"
FT                   /translation="QNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSL
FT                   VINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYT
FT                   QEDYTMLGSDDFFYVGGSPSTADLPGSPV"
FT   CDS             join(<1..245,3437..>3569)
FT                   /codon_start=3
FT                   /gene="Nrxn1"
FT                   /product="neurexin 1 NRXN1-7"
FT                   /db_xref="GOA:Q9CS84"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR003585"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027789"
FT                   /db_xref="InterPro:IPR037440"
FT                   /db_xref="MGI:MGI:1096391"
FT                   /db_xref="PDB:3BOD"
FT                   /db_xref="PDB:3MW2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CS84"
FT                   /protein_id="AAK70471.1"
FT                   /translation="QNPIQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSL
FT                   VINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLG
FT                   SDDFFYVGGSPSTADLPGSPV"
FT   exon            <1..245
FT                   /gene="Nrxn1"
FT                   /number=6
FT   exon            2321..2365
FT                   /gene="Nrxn1"
FT                   /number=7b
FT                   /note="alternative"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            2321..2344
FT                   /gene="Nrxn1"
FT                   /number=7a
FT                   /note="alternative"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            3437..>3569
FT                   /gene="Nrxn1"
FT                   /number=8
XX
SQ   Sequence 3569 BP; 965 A; 729 C; 711 G; 1164 T; 0 other;
     ctcaaaaccc cattcaaagc agcagcgatg aaataactct gtcctttaaa actcttcaaa        60
     ggaacggact gatgcttcac acagggaaat cagctgatta tgtcaatctt gcattgaaaa       120
     atggagctgt ctctctggtc attaatttgg gatcaggggc ctttgaagca ctagtggagc       180
     ctgtgaatgg aaagtttaat gataatgcct ggcatgatgt gaaagtcacc aggaatctgc       240
     gtcaggtaac aacgcagtgg ataagatagt aactgccttt gtttcttgct acagctgtgc       300
     ctgtggtacc tacagctgtc tgtgtggtac ttgaaaacct tacccacatg atatagggct       360
     cctgagatta gcttttcctt ctgagatgaa tcttcctgcc acacttgagc aggggcattt       420
     ctagaaagtt ctgagggccc aaaggctatt ttaatacagt gacaaatgat tattttccag       480
     agggctgtta aggatatccc ttcgacctgc ccttcctgta atgtgtatga ttttattttt       540
     tttttcgttt gtttgtttga ttgaaaatta tagttttctt agtgatcatt tggaagcatg       600
     cacattgggg tcattaaatc acacttcctt ttttttgtag taaaaaaaca aacaaaaacc       660
     tttatttttg tcccttggga ttgaagcaat tcctattccc tccccttccc caccccaaaa       720
     tgggaaacat aaaaatgtcc cttgagggaa aaaaatcgat attgtgtgta accctatgtt       780
     ctgaagtttt tgtttatgaa gatatttttt aattttaaca caaggatact ttaatttaaa       840
     ctataaattg atatgaaaag gtcccttcat cctcttctac tggaatataa ttatatttac       900
     atatttaaat tcttacacaa gtctatatac tagagaattc acacttcttc acggaatcca       960
     atgagtctta catatacctg tatgttttct aataaagacg gtattacagt atatgctgaa      1020
     acccaattag attgtttttg tattttcatc cattatgagt tctgattata tgacatttta      1080
     ctttataatg tatcattttt gtaaagtgct gacaaagtga cttaattttt gaatggtaaa      1140
     tgcttatcga aaactaacat ccttaatgca tttgttgttt ctctgaacag ttgcagaatg      1200
     accgattgac tttggttccc cttcactaaa atgacccttt ttctgagctg ttaactaacc      1260
     ctttccttcc tgcttctgag aggcttcaac tatctgagct agacaagaca aagttgctta      1320
     ggcagggaga tttagttaca ttcaggcaga caaacaaaac tgtaaaactt tgagaatttc      1380
     caaggctatt tagatgccca tgggcatggg aggagccaca tgcttcccac agtgttggga      1440
     gggggtggcc acagtcagcc tagttataga ccatgggttt cctgtaagtc tgtctctttg      1500
     gttttctgtt ttcatttttc cctctcatat actccccaag agactggagg cttcacttgg      1560
     gtgaccacag aaggaagggt gggccttgag gagcccactt tctagatttg cctttgctca      1620
     ggttacaaag caagttgaga attcgtagtt ccaagaaaac agaagtttat gcagccaggg      1680
     tgcatgtgca gcaggagaga ttacaaacaa gtccattcta ctcattatgt gtgtcaggat      1740
     ctctgctctg tttcattgca gtatactgtg accataaagt ccatcaatat gacggaagga      1800
     agttttggaa ttgaggaggg gtccttgtat gctgtaaaat tgagtagtag ggcaaagcca      1860
     actgattcct actaatttgc tgggactggg tgtgggtgtg gagggggact atgattgggc      1920
     gagggtgaca atgaccagct gataggcttc aggcctttga atgaatcttt tgcagaagtt      1980
     tacaatggct ctcagtggtc ctcaggaaga ctaagggaac agtgccacgt gtctgtctct      2040
     gtctagggcc aagagatgaa caagggcagg aaaagattat ctcctctgtg ggaggcctat      2100
     ttgttagtct gctttttctt gtaaaatttt tttgcccttt ttctatgtta ctaacatgct      2160
     taataactaa catgccattc atggaatgtt tcattctact aaccgttacc tgaatcaaaa      2220
     aatgtactaa catggtagag accatcatgt tttttaagta acgatcgatc gttattctgt      2280
     tcacagtttt aatttccttt ctcccccctt ctccacaaag cactcaggca ttggacacgc      2340
     tatggtaaac aaactacatt gttcggtaga tatcattcta attgtttctt attttgggtt      2400
     tgccgtgtgt tttctttctt tcttttaact gtagacatca ttaacaaaag aggaactgcg      2460
     gttggtactc ttctgcttac ctgacctcct tcttttcatc tgttgttgac tttcttattt      2520
     tttacctgtt cctgtcaacc tgttttcgaa ctcacctgta aggggcatcg cttaacgttt      2580
     cgaacgttta ttttcttatt tttttatttt ttattttttg catccagctg tggttaacac      2640
     gagataagaa aatggtggct ggcccgagtg accgcaggct cagccagtct ctaaccattc      2700
     atgatgcatg gcatggaaac ttggtttggg aatgttggag atgccacacc cactcatctt      2760
     tacgtcatca ttatgcagtt atctttctcc tttggttctc cctgtcttct tttcttttgc      2820
     ctttccttcc cttccctttg ctttcctttc ctttcctttc agagcgttct gtacctcctg      2880
     catgcgcatc gctggtgccg cttcactgat tgtttttgcg ccttcatctt ccctcgggca      2940
     ttggttcagg cacttgcatg ctcaacagtt ggctgctcca atagtgcaaa atagtgatgt      3000
     tgctggaaat agcttgcgcc tttttctgtt aacaaggtgc acgttgtgat tagtgaataa      3060
     cagacgacta aactttacta atatgtacac cagcaaaact aacctaggag gcattttact      3120
     aacaccattt ttgtgtctgc taaataactt ttgagttgca gcagggatga tgctgacact      3180
     agttcaatga tcagttaact ctctaactag attagaatct ctcagggcta gctgaataga      3240
     atccaagaat aaacctcaaa cagacatgaa aatgggttcc gccacagggc taaaactgaa      3300
     aaccaaacaa acataaaaaa aaaaaaaaaa gcaaaacaaa aactataata aagcaaaaca      3360
     caaaacaggc atatcccagg attacagcat gtaggtctga gtatagcgtg tcctttccct      3420
     gtgctttgtc atctaggtga caatatcagt ggatggaatt cttaccacaa cgggctacac      3480
     gcaagaagat tacaccatgc tggggtctga tgactttttc tatgttggag gcagccccag      3540
     cacagccgac cttccagggt caccagtca                                        3569
//