spacer

EBI Dbfetch

ID   AF368423; SV 1; linear; genomic DNA; STD; MUS; 5065 BP.
XX
AC   AF368423;
XX
DT   15-OCT-2001 (Rel. 69, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus S100 calcium binding protein A1 (S100a1) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5065
RX   DOI; 10.1128/MCB.22.8.2821-2829.2002.
RX   PUBMED; 11909974.
RA   Du X.J., Cole T.J., Tenis N., Gao X.M., Kontgen F., Kemp B.E.,
RA   Heierhorst J.;
RT   "Impaired cardiac contractility response to hemodynamic stress in
RT   S100A1-deficient mice";
RL   Mol. Cell. Biol. 22(8):2821-2829(2002).
XX
RN   [2]
RP   1-5065
RA   Heierhorst J.;
RT   ;
RL   Submitted (04-APR-2001) to the INSDC.
RL   Molecular Genetics Lab, SVIMR, 9 Princes Street, Fitzroy, VIC 3065,
RL   Australia
XX
DR   MD5; 8a9016f5ba3e1e364f564ec85affff18.
DR   Ensembl-Gn; ENSMUSG00000044080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060738; mus_musculus.
DR   EuropePMC; PMC133731; 11909974.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5065
FT                   /organism="Mus musculus"
FT                   /strain="129/Sv"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(975..1081,3151..3304,3936..4264)
FT                   /gene="S100a1"
FT                   /product="S100 calcium binding protein A1"
FT   CDS             join(3164..3304,3936..4079)
FT                   /codon_start=1
FT                   /gene="S100a1"
FT                   /product="S100 calcium binding protein A1"
FT                   /note="S100A1"
FT                   /db_xref="GOA:Q91V77"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028486"
FT                   /db_xref="MGI:MGI:1338917"
FT                   /db_xref="UniProtKB/TrEMBL:Q91V77"
FT                   /protein_id="AAL14436.1"
FT                   /translation="MGSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGF
FT                   LDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS"
XX
SQ   Sequence 5065 BP; 1343 A; 1358 C; 1200 G; 1164 T; 0 other;
     gatctagaaa gggactcttc aaactcctca catccacaac ccacaaagtg tttggcctgg        60
     acaccagggc cttcgggggt ccacgaaggg aagaaacatg cccactcgtc ccctcatttc       120
     tgtctgtcca cccacccaca tactcctccg gggaccgttg cctgctctcc taaagtcact       180
     tcctgaatct ctgcctgaac ccgcttggaa ggagggaccc gggagctgat aaagaaagga       240
     aggtctccag gttctctgca gtcaggaaaa gtaactcacc gggaaagaag gtgggatgca       300
     gctaaccgat ctggagccct gaggctgaag tttataagca ccaggcaagg cgagagccac       360
     tcccaagtct gaagtgtcaa gtttccgcct ccgctgaggg gaccgcccct gctgtcacta       420
     gccatcccaa cacagcgcca cgcgactggg acacagcctg atcaggaagg accacagggt       480
     ctcatccctc ccaattatga gggctacttg ggagtctgtg ttagagggac tgctactgct       540
     gcttgaaaaa gattaaaaag aaaagcaaac aaaatatact tgggggattc cagcactgaa       600
     aaatcccctt ctgagaaggc aaagagatcc aaaggcactc ggagagcccc agactaaggg       660
     tcccatagtg gaactcctat tgaaattctt cactgagttc cgagacagaa gcccctgtcg       720
     gaggcgcaca ggctaagcac tcctgggcag aatccttccc tttccctgct cagcccgcac       780
     cgcagcaccc agcaccatag cacccttccc tcgacctcct tcccttccac ctacttcccg       840
     ctaggctcag ggaggtggtg caagcaagaa cggaaagaaa cacaggacag ccccttccct       900
     cctgggagac agagggcgcc tctgtccact cctggccctt agccctttgg gtgtcgtttg       960
     tgaaggggtg gagccgttgg ggaggaggtc ggtagggaaa gacgactaaa agacaggtct      1020
     cctcacaccg gtccagtggc cacatttgca gcgtgccctt ctgtcgagaa tctgttccga      1080
     cgtcaggccg aggccaaccg tgagtatcct accctgctta ggataggtct ctctggctta      1140
     gccagcctgg aagaaaggga acttcagaag gaccccaaga gccctggaaa aggatactgt      1200
     ggtgtccggg aggagtcggt caagggaaag agcagttcgg gaactaggga tgatgaagtt      1260
     tggaaagtag tgagaggagg tgagtgaagg tcagagagct gggagcgtgt ggtgaatgag      1320
     ggcgccaccc agcttccagg ctaccaggtc ttcctacaca gaatcctgtg tctcctgcca      1380
     gggacgccag tctctaggtg tgggcaggga ggagatacag ccctgctcct tcagggtaag      1440
     aataagaaaa gctgtccctg ccccttctcc accctcactc tctgccttct caagagccag      1500
     ggaaggctcc tagcagtgga gcttaacgtc atgtggtatc tttcttaaag aagggggtct      1560
     gtggcggtgt gcactgtccc atctctgcct cacagacctc ctctctagcc cttctttctc      1620
     agccttgacc ccctctcctc tctcccctaa tttttccctc tttgtttccc actgctccaa      1680
     gcccagatcc tcccctacat aaaattccaa gctgctagag ggttccaggc aacctccaga      1740
     tgcccctcat agatgagaat ggtaaccgag ccgcccaaat tcctcccttg agcaccctct      1800
     tatccctttg atcagcctgg cttgaattct ctctcccact gtctctgtaa caactgcttc      1860
     ttgtgactgg agttcaggtg acagtcacaa gggctccact gaagagctgg catgtcatct      1920
     aatcaggacc cattgtccag aatactcagt ggtgaagaag gatgaggaca cctgagctga      1980
     gacacatgag caacccctga ggctgtggaa ggcatgaccc tcccagggcc gaaagatcga      2040
     gccccccacc ccaccccagt ttagtagtct cttctcaata gacttctcca ttctcccact      2100
     ctcgcccagc ccttgagctc aaatgacctc atacattcag ccctttatca aacacaaacc      2160
     agccctagcc tgctcccact ggagctaccg aaccaacgct ggcccgtggc agcaatggac      2220
     agcatcagga agaacaccta caaagctcgt ctccaaggaa aagcctcaga catctcttct      2280
     cccttccttc tacctacctg atggaaaggg atgattttgc agagaaaagg actagaacag      2340
     gcagtcatgt taagaatacc gccataccgc cccccccacc cccgtccccc aaagaagcca      2400
     aaatggcatg ctgaagagag agggggaact cagaccagta atctcagcac acagagacac      2460
     gactgcccag aagctaagga tctgcttgag ctaattccag gacagcacag gctacagagt      2520
     gtgaccctgc tataaataaa taaatcccaa gcacaaaaag atggagatgt agccaaaggg      2580
     acctgggctg aatcctcggt atcttaagag gaagagccat gcttgctgac aggaagcttg      2640
     ggaacagtaa gacacctctt cctcactgac cccccatcag ctcaccaaag gtatcagact      2700
     tcttcctggg gtagcagagg agatcgtagc ccacttagta gcaacaacaa agcttaactg      2760
     tgacaggcct ggaagtaaaa ctagagctcg aagcctgcct ggtccttgtg tccacccatg      2820
     tctcccctcc cgctccccag ccttgagtca gccactgcag atgtcttttg caggcttctg      2880
     aagacagtcc agttcctatt gcttcatctc catgcctatc cctgactccc tctgacgggg      2940
     aaatgataga gggacccaaa acgctggacc agatttagtg ctagggtttc tcctacactg      3000
     caaaatctga atgaaagata aagtacaatg aggttcatct cgcagctatt tgagcgaatc      3060
     cagggccagg gctgaagatt tcccttaccc agaccacaga tgtcctgaat ctggtttata      3120
     attcacttcc atctttgtgg gaatgggtag gtgtgctgct gaaatgggct ctgagctgga      3180
     gagtgccatg gagaccctca tcaatgtgtt ccatgcccat tcgggcaagg aaggggacaa      3240
     atataagctg agcaagaaag aactgaaaga cctgctacaa actgaacttt ctggcttcct      3300
     ggatgtaagc acaggattga ggtacagggt ggaggaaggg gatgtagccc cagctggcat      3360
     ggaacttgct atgtagatca ggctggcctt gaactcaaat agacctacct gcttctctcc      3420
     cccactgagt gctaggatta aaggcatcgc tgtgccctaa aatgattttg tgtgtgaatt      3480
     tttaattaaa tgaaagaaag tctgtaaggt tcccagcttg tcacaatgta gacaatcatg      3540
     tatgacaaca gatgtaacta ttaactctgc ttagttctat aggtcaccag tttttggttt      3600
     ttttttttta agatttattt atttattaca tgtaagtaca ctgtagctgt ctttagacac      3660
     atcagaaaaa ggcgtcagat cttgttacgg atggttgtga gccaccatgt ggttgctggg      3720
     atttgaactc cggacctttg gaagagcagt cgggtactct tacccactga gccatctcac      3780
     cagtcccagg tcaccagttc ttaactcacc agtctttaag gttgtagaag actcccataa      3840
     ttaaatatca ttctctcact tgctcatttc cacctcctcc tccaccacca tggtggctct      3900
     gacttagtga taaacacttc catccccttc tacaggtcca gaaggatgca gatgctgtgg      3960
     acaaggtaat gaaggaactg gatgaaaacg gagatgggga agtggacttc aaggagtatg      4020
     ttgtgctggt ggctgctctc acagtggctt gtaacaactt cttctgggag accagttgag      4080
     cacagtctgt gagcagtgcc cttcctctcc cacttgtcaa gatttcccct ttagcgtgct      4140
     tgctcctcac cccacctgta cctccctatg tccccatcct tgcccagtct cgacgtgcac      4200
     caagggcaca agagtggcag tccagatctg ccacttgttt taataaagcc ttctctctca      4260
     ccagctatca atgtctgtac cctctgggca tggctatgtg tgaagtaagg ggtgctcact      4320
     cccaacacct tatcttgtca agtttacatt agttccttat ttaaggaaca ctcaaaaccc      4380
     agaaatgtag gggtccgaaa attttagctg gaatccaagt gtcattggct tctcaaggat      4440
     ttgtatgagt aattggtaat accaggactt gaaggatgag gcaggaagat tttgagttcc      4500
     aagccagccc atactacata gccagaaaca gaaataaaca agccatcaaa aaatgtgggg      4560
     ctggtgagat ggctgagtgg gtaagagtac ctgactgctc ttccaaaggt ccggagttca      4620
     aatcccagca accacatggt ggctcacaac catccgtaac gagatctggt gccctcttct      4680
     agtgtgtctg aagacatcta cagtgtactt acatataata aataaataaa tcttttttaa      4740
     aaaatctgaa gaaagctaga aatggtggca cgtaccatag ttaacaccag ctcagcacct      4800
     gggacgtaaa aggcaggagg atctctgtga gtccaagccc agcctggtct gtatagagaa      4860
     ttctagaaca gccagaacta cattatagag actctgtctc aaaaaaacta ccagaggcag      4920
     tggtgacaca cgcctttaat cccagcactc gggaggcaga ggcaggcaga tttctgagtt      4980
     caaggccagc ctggtcaaca gagtgagttc caggacatcc aaggctacac agagaaaccc      5040
     tgtctcggaa aaaaaaaaaa aaaaa                                            5065
//


spacer
spacer