Dbfetch

ID   AF362764; SV 1; linear; mRNA; STD; MUS; 1392 BP.
XX
AC   AF362764;
XX
DT   09-MAY-2001 (Rel. 67, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus glycine receptor alpha 3 subunit (Glra3) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1392
RA   Noegel S., Becker C., Becker K.;
RT   "Different glycine receptor isoforms are expressed in murine cerebellum";
RL   Unpublished.
XX
RN   [2]
RP   1-1392
RA   Noegel S., Becker C., Becker K.;
RT   ;
RL   Submitted (21-MAR-2001) to the INSDC.
RL   Biochemistry, University of Erlangen, Fahrstrasse 17, Erlangen 91054,
RL   Germany
XX
DR   MD5; 10604242afe80ead335e4eed9f629da0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1392
FT                   /organism="Mus musculus"
FT                   /chromosome="8"
FT                   /map="26 cM"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /tissue_type="spinal cord"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1392
FT                   /codon_start=1
FT                   /gene="Glra3"
FT                   /product="glycine receptor alpha 3 subunit"
FT                   /note="ligand-gated ion channel"
FT                   /db_xref="GOA:Q91XP5"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008127"
FT                   /db_xref="InterPro:IPR008130"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:95749"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91XP5"
FT                   /protein_id="AAK51962.1"
FT                   /translation="MAHVRHFRTLVSGFYFWEAALLLSLVATKETNSARSRSAPMSPSD
FT                   FLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDP
FT                   RLAYSYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIR
FT                   LTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLK
FT                   EEKDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAA
FT                   PARVALGITTDLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVS
FT                   RQHKELLRFRRKRKNKTEAFALEKFYRFSDTDDEVRESRFSFTAYGMGPCLQAKDGVVP
FT                   KGPNHAVQVMPKSPDEMRKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHEDI
FT                   HHQQD"
XX
SQ   Sequence 1392 BP; 388 A; 310 C; 313 G; 381 T; 0 other;
     atggcccacg tgagacactt tcggacacta gtttctggat tttacttctg ggaagccgca        60
     ctgttactga gtttggtggc cacaaaggaa acaaacagtg cgcgatctcg aagtgctcca       120
     atgtcacctt ctgattttct ggacaaacta atggggagga catcggggta tgatgcaaga       180
     atcagaccca acttcaaagg tcctccagtt aatgtcacat gcaacatatt cataaacagc       240
     tttggctcca ttgcagagac gactatggat tacagagtaa acatttttct tcgtcagaag       300
     tggaatgatc ctcgtcttgc atacagttat cctgacgatt cattagacct tgacccgtct       360
     atgttggatt ccatttggaa acctgacttg ttctttgcta atgagaaggg ggctaacttc       420
     cacgaagtca ccacagataa caagctgcta agaattttca aaaatggaaa tgtcctttat       480
     tcaataaggt tgacattaac actctcctgt ccaatggatc tcaagaattt cccaatggat       540
     gtacaaacat gcataatgca acttgaaagc tttgggtaca caatgaatga tctcattttt       600
     gaatggcaag atgaagcccc agtacaagtg gctgaaggac tcactttgcc tcaatttctg       660
     ttgaaagaag aaaaggactt gcggtactgc actaaacact acaatacagg aaagtttaca       720
     tgcatagaag tgcgattcca tcttgagcgt cagatgggct attacttgat ccagatgtac       780
     atccccagcc tcctgatcgt tattctatcc tgggtctcat tctggattaa catggatgca       840
     gccccagcta gagtagcttt gggcatcacc actgatctta ctatgaccac acagagttct       900
     ggatcccggg cctccttacc aaaggtgtca tacgtcaagg ctattgacat ttggatggcg       960
     gtgtgcctcc tttttgtgtt ctcagcactt ctggagtatg cagccgtgaa ttttgtctca      1020
     aggcaacaca aggagctgtt gaggtttcgg cgaaagagaa agaataagac ggaagctttt      1080
     gcactggaga agttttaccg tttctcagac acggatgatg aggtgaggga gagtcgattc      1140
     agcttcactg cctatggaat ggggccctgt ctgcaagcca aggatggtgt ggttccaaaa      1200
     ggccccaacc acgctgtcca ggtcatgcca aagagccctg atgaaatgag gaaggtcttc      1260
     atcgacaggg ctaagaagat tgacaccatc tcccgagcct gctttccgct agctttcctg      1320
     atttttaaca ttttctactg ggttatctat aaaatcctta ggcatgaaga cattcatcat      1380
     cagcaagatt aa                                                          1392
//