Dbfetch

ID   AF361348; SV 1; linear; mRNA; STD; MUS; 783 BP.
XX
AC   AF361348;
XX
DT   22-DEC-2001 (Rel. 70, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus voltage-dependent calcium channel gamma-6 subunit (Cacng6)
DE   mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-783
RX   DOI; 10.1016/S0378-1119(01)00738-7.
RX   PUBMED; 11738816.
RA   Chu P.J., Robertson H.M., Best P.M.;
RT   "Calcium channel gamma subunits provide insights into the evolution of this
RT   gene family";
RL   Gene 280(1-2):37-48(2001).
XX
RN   [2]
RP   1-783
RA   Chu P.-J., Robertson H., Best P.M.;
RT   ;
RL   Submitted (14-MAR-2001) to the INSDC.
RL   Department of Molecular and Integrative Physiology, University of Illinois,
RL   407 S. Goodwin Ave., Urbana, IL 61801, USA
XX
DR   MD5; 0e0b8856c1f647d325d7aca5b72b52cf.
DR   Ensembl-Gn; ENSMUSG00000078815; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182493; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183200; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..783
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..783
FT                   /codon_start=1
FT                   /gene="Cacng6"
FT                   /product="voltage-dependent calcium channel gamma-6
FT                   subunit"
FT                   /db_xref="GOA:Q8VHW3"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR008368"
FT                   /db_xref="InterPro:IPR008370"
FT                   /db_xref="MGI:MGI:1859168"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VHW3"
FT                   /protein_id="AAL50043.1"
FT                   /translation="MMWSNFFMQEEDRRRTAVGRRRAQEQQNLGLTPEREGKIKLGLLV
FT                   AIVGATLAVLAVGTEFWVELNTYKTNGSAVCEAAHLGLWKVCIKRLWQADVPAGRETCG
FT                   PAELPGEANCTYFKFFTTGENARIFQRTTKKEVNLAAAVIAVLGLTAMALGCLCVIMVL
FT                   SKGAESLLRLGAVCFGLSGLLLFVSLEVFRHSVGALLQGVNPETPPAPRLAYEYSWSLG
FT                   CGVGAGLILLLGGVCFLLLTLPSWPWRSLCPKWGGPTA"
XX
SQ   Sequence 783 BP; 141 A; 218 C; 253 G; 171 T; 0 other;
     atgatgtggt ctaacttctt catgcaagag gaagaccgac gccggacagc tgtgggccgg        60
     cgtcgtgccc aagaacagca gaatctcggc ttgactccgg agcgagaggg caagatcaag       120
     ctggggttgc tggtggcaat cgtgggtgct acgctggctg tgctggctgt gggcaccgag       180
     ttctgggtgg aactcaatac atacaagacc aatggcagcg ccgtctgtga ggccgcccat       240
     ttggggctgt ggaaggtgtg catcaagcga ctgtggcagg cggatgtgcc cgcgggcagg       300
     gagacctgtg gcccagctga gctgccagga gaagcaaact gcacctactt caaattcttc       360
     accacggggg aaaatgcgcg catcttccag cgaaccacca agaaagaggt aaacctggca       420
     gctgccgtga tagctgtgct gggcctgacg gccatggcct tgggctgcct ctgtgtcatc       480
     atggtgctca gtaaaggtgc agagtccctg ctccgattgg gagctgtctg ctttggcctc       540
     tcaggcctgc tgctctttgt cagcctggag gtgttccggc attccgtagg agccctgctg       600
     cagggagtca accctgagac ccctccagct ccacgcctgg cctatgagta ttcctggtcc       660
     ttaggctgtg gtgtaggcgc tggtctaatc ctgctgctgg ggggagtctg tttcctcctg       720
     ctcaccttgc cttcctggcc ctggaggtca ctgtgcccca agtggggtgg cccaaccgcc       780
     tag                                                                     783
//