Dbfetch

ID   AF346663; SV 1; linear; mRNA; STD; MUS; 1883 BP.
XX
AC   AF346663;
XX
DT   02-AUG-2001 (Rel. 68, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus Lutheran glycoprotein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1883
RX   DOI; 10.1002/dvdy.1169.
RX   PUBMED; 11507772.
RA   Moulson C.L., Li C., Miner J.H.;
RT   "Localization of Lutheran, a novel laminin receptor, in normal, knockout,
RT   and transgenic mice suggests an interaction with laminin alpha5 in vivo";
RL   Dev. Dyn. 222(1):101-114(2001).
XX
RN   [2]
RP   1-1883
RA   Moulson C.L., Miner J.H.;
RT   ;
RL   Submitted (07-FEB-2001) to the INSDC.
RL   Renal Division, Department of Internal Medicine, Washington University
RL   School of Medicine, 660 South Euclid Ave., Saint Louis, MO 63110, USA
XX
DR   MD5; b9521a20cf32d9c2d89b7e4e1dfd0047.
DR   Ensembl-Gn; ENSMUSG00000002980; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031795; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031771; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031697; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031776; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031498; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032242; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030841; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031460; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031615; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031567; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031698; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031603; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032270; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030565; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030941; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003061; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082064; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0082141; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0082079; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082086; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081697; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082564; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082218; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0081638; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0081797; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0081673; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0081832; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081696; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082834; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081644; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080747; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1883
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1869
FT                   /codon_start=1
FT                   /product="Lutheran glycoprotein"
FT                   /db_xref="GOA:Q9R069"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1929940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R069"
FT                   /protein_id="AAK83237.1"
FT                   /translation="MEPPDARAGLLWLTFLLSGYSGAQAELHVSVPPRVEVMRGEQVAL
FT                   DCTPREHPEHYVLEWFLVDGTGARHRLASVEPQGSEFLGTVHSLGRVPPYEVDSRGRLV
FT                   IAKVQVGDGRDYVCVVKAGAAGTSEATSSVRVFATPEDTEVSPNKGTLSVMDQFAQEIA
FT                   TCSSNNGNPVPRITWYRNGQRLEVPMEVNQKGYITIRTVREASGLYSLTSTLYLRLHKD
FT                   DRDANFHCAAHYDLPSGQHGRLDSHTFRLTLHYPTEHVEFWVGSPSTTEGWVREGDAVQ
FT                   LLCQGDGSPSPEYSFFRQQGTQEEQLNVNLKGNLTLERVHRNQSGIYGCRVEDYDADEE
FT                   VQLVKKLKLHVAYLDPLELSVPEELFVFLNSSSTVVNCSARGLPTPTVRWTKDSVTLAD
FT                   GPMLSLQSVTFDSAGTYTCEASTPTVPLLSRTQSFQLIVQGAPELKPNEIMPKSGNSWT
FT                   EGDEVMLTCSARGFPEPKLTWSQRGDTPAEPPFEGRGWKSSSLMVKVTSALSREGVSCE
FT                   ASNIHGKKGHVFHFGSVAPQTAQAGVAVMAVAVSVGLLLLVVAAFYCMRRKGRPGCCRR
FT                   AEKGAPPAREPELSHSGSERPEHTGLLMGGPSGGGRGGSGGFGDEC"
XX
SQ   Sequence 1883 BP; 394 A; 551 C; 577 G; 361 T; 0 other;
     atggaacccc ctgacgcccg cgcagggctg ctgtggctca ccttcctgct gtcgggctac        60
     tcaggtgccc aggctgagct gcacgtgtcc gtgcccccac gggtggaggt gatgcgaggc       120
     gagcaagtcg ccctggactg cactccacgg gagcaccctg agcattacgt gctggaatgg       180
     ttcctcgttg atggtactgg ggctcgacac cgtctggctt ctgtggaacc acagggctca       240
     gagttcctgg gcacagtcca ctctctgggc cgcgtacccc catacgaggt agactctcgt       300
     gggcgcctgg tgatagcaaa ggtccaggtg ggcgatggac gggactacgt gtgcgtagtg       360
     aaggctgggg cagcgggtac ctcagaggcc acctcaagtg tccgtgtgtt tgcaacacca       420
     gaggatacgg aggtgtctcc caacaaaggg acgctgtctg tgatggacca gtttgcccag       480
     gagattgcca cctgcagcag caacaacgga aaccccgtgc ctcggatcac atggtaccga       540
     aacgggcagc gtctggaagt acccatggag gtgaaccaaa agggctacat aaccatccgt       600
     actgtccggg aagcctcagg cctgtactcc ctgaccagca ccctctacct gaggctgcac       660
     aaggatgatc gggatgccaa cttccactgt gctgctcact acgacttgcc ctcaggccaa       720
     catggccgcc tggacagcca tacctttcgc ctcaccctgc actatcccac ggaacatgta       780
     gaattctggg tggggagccc gtccaccacg gagggctggg tccgtgaggg tgatgctgtc       840
     cagctgctct gccagggcga tggcagcccc agcccagagt attctttttt ccgccagcag       900
     ggtacccagg aggaacagct gaatgtcaac ctcaagggaa acttgaccct agaacgggtg       960
     catcggaacc agagcgggat ctacggctgc agagtggagg attacgatgc cgacgaggaa      1020
     gtgcaacttg tcaagaagct aaagctgcac gtggcctacc tggatccatt ggagctgagc      1080
     gtgcctgagg agctcttcgt attcctgaac agcagcagca cggtggtgaa ctgctccgct      1140
     agaggcctgc ctactcctac tgtgcgatgg accaaggatt ctgtgaccct tgcagacggc      1200
     cccatgctct ctctccagtc tgtgaccttt gactcagctg gcacctatac ctgtgaggcg      1260
     tccacaccca cagtccccct cctgagccgc acacagagtt tccagctcat cgtccaagga      1320
     gcaccagagt taaaaccgaa tgagataatg cccaaatcag ggaatagctg gacagaaggc      1380
     gatgaagtca tgctgacctg ctccgcccgg ggcttcccag agcccaaact cacctggagt      1440
     cagcgaggcg atactccagc agagccgccc tttgagggta gaggctggaa gagcagctcg      1500
     ctgatggtga aagtgaccag cgccctgagc cgagagggcg tgtcctgtga agcgtctaac      1560
     atccatggca agaaaggcca tgtcttccac tttggctctg tggcccctca gactgcccag      1620
     gctggagtgg ctgtcatggc tgtagctgtc agcgtcggtc ttttgctact cgtggtcgct      1680
     gctttctatt gcatgagacg caaagggcgc cctggctgct gccggcgagc agagaaaggg      1740
     gcgccgccag ccagggaacc ggagttgagc cactctgggt cagagcggcc agaacacacg      1800
     ggccttctca tgggtgggcc ctccggagga ggcagaggtg gcagtggagg ctttggagat      1860
     gagtgttgag gctgacgacc tcc                                              1883
//