spacer

EBI Dbfetch

ID   AF333485; SV 1; linear; genomic DNA; STD; MUS; 2139 BP.
XX
AC   AF333485;
XX
DT   31-MAY-2001 (Rel. 67, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Mus musculus calcitonin receptor gene, exon 14 and complete cds,
DE   alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2139
RX   DOI; 10.1074/jbc.M007104200.
RX   PUBMED; 11309373.
RA   Anusaksathien O., Laplace C., Li X., Ren Y., Peng L., Goldring S.R.,
RA   Galson D.L.;
RT   "Tissue-specific and ubiquitous promoters direct the expression of
RT   alternatively spliced transcripts from the calcitonin receptor gene";
RL   J Biol Chem 276(25):22663-22674(2001).
XX
RN   [2]
RP   1-2139
RA   Anusaksathien O., Li X., Ren Y., Laplace C., Goldring S.R., Galson D.L.;
RT   ;
RL   Submitted (04-JAN-2001) to the INSDC.
RL   New England Baptist Bone & Joint Institute, Beth Israel Deaconess Medical
RL   Center and Harvard Medical School, Harvard Institutes of Medicine, Rm247, 4
RL   Blackfan Circle, Boston, MA 02115, USA
XX
DR   MD5; 305a9383be6c80e74a0b9773e8657aed.
DR   Ensembl-Gn; ENSMUSG00000023964; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115622; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168592; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171613; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2139
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /strain="129"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   intron          <1..199
FT                   /number=13
FT                   /note="3.8 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   mRNA            join(AF333472.1:1381..2062,AF333472.1:3087..3273,
FT                   AF333474.1:86..164,AF333475.1:88..241,AF333476.1:96..206,
FT                   AF333477.1:239..351,AF333478.1:179..270,
FT                   AF333479.1:298..424,AF333481.1:174..327,
FT                   AF333482.1:185..245,AF333482.1:327..393,
FT                   AF333483.1:131..349,AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform Cla-2"
FT                   /note="P1.2 5'-UTR minus exon 8b; composed of exons 1, 2c,
FT                   3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(AF333472.1:1381..2062,AF333472.1:3087..3273,
FT                   AF333474.1:86..164,AF333475.1:88..241,AF333476.1:96..206,
FT                   AF333477.1:239..351,AF333478.1:179..270,
FT                   AF333479.1:298..424,AF333480.1:197..307,
FT                   AF333481.1:174..327,AF333482.1:185..245,
FT                   AF333482.1:327..393,AF333483.1:131..349,
FT                   AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform Clb-2"
FT                   /note="P1.2 5'-UTR plus exon 8b; composed of exons 1, 2c,
FT                   3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(AF333472.1:1381..2062,AF333472.1:3087..3273,
FT                   AF333473.1:222..329,AF333474.1:86..164,AF333475.1:88..241,
FT                   AF333476.1:96..206,AF333477.1:239..351,AF333478.1:179..270,
FT                   AF333479.1:298..424,AF333481.1:174..327,
FT                   AF333482.1:185..245,AF333482.1:327..393,
FT                   AF333483.1:131..349,AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform Cla-1"
FT                   /note="P1.1 5'-UTR minus exon 8b; composed of exons 1, 2c,
FT                   3a, 3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(AF333472.1:1381..2062,AF333472.1:3087..3273,
FT                   AF333473.1:222..329,AF333474.1:86..164,AF333475.1:88..241,
FT                   AF333476.1:96..206,AF333477.1:239..351,AF333478.1:179..270,
FT                   AF333479.1:298..424,AF333480.1:197..307,
FT                   AF333481.1:174..327,AF333482.1:185..245,
FT                   AF333482.1:327..393,AF333483.1:131..349,
FT                   AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform C1b-1"
FT                   /note="P1.1 5'-UTR plus exon 8b; composed of exons 1, 2c,
FT                   3a, 3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(AF333472.1:2872..2904,AF333472.1:3087..3273,
FT                   AF333474.1:86..164,AF333475.1:88..241,AF333476.1:96..206,
FT                   AF333477.1:239..351,AF333478.1:179..270,
FT                   AF333479.1:298..424,AF333480.1:197..307,
FT                   AF333481.1:174..327,AF333482.1:185..245,
FT                   AF333482.1:327..393,AF333483.1:131..349,
FT                   AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform Clb-2"
FT                   /note="P2.2 5'-UTR plus exon 8b; composed of exons 2a, 2c,
FT                   3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(AF333472.1:2872..3273,AF333473.1:222..329,
FT                   AF333474.1:86..164,AF333475.1:88..241,AF333476.1:96..206,
FT                   AF333477.1:239..351,AF333478.1:179..270,
FT                   AF333479.1:298..424,AF333480.1:197..307,
FT                   AF333481.1:174..327,AF333482.1:185..245,
FT                   AF333482.1:327..393,AF333483.1:131..349,
FT                   AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform C1b-1"
FT                   /note="P2.3 5'-UTR plus exon 8b; composed of exons 2a, 2b,
FT                   2c, 3a, 3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(AF333472.1:2872..2904,AF333472.1:3087..3273,
FT                   AF333473.1:222..329,AF333474.1:86..164,AF333475.1:88..241,
FT                   AF333476.1:96..206,AF333477.1:239..351,AF333478.1:179..270,
FT                   AF333479.1:298..424,AF333481.1:174..327,
FT                   AF333482.1:185..245,AF333482.1:327..393,
FT                   AF333483.1:131..349,AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform C1a-1"
FT                   /note="P2.1 5'-UTR minus exon 8b; composed of exons 2a, 2c,
FT                   3a, 3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(AF333472.1:2872..3273,AF333474.1:86..164,
FT                   AF333475.1:88..241,AF333476.1:96..206,AF333477.1:239..351,
FT                   AF333478.1:179..270,AF333479.1:298..424,
FT                   AF333481.1:174..327,AF333482.1:185..245,
FT                   AF333482.1:327..393,AF333483.1:131..349,
FT                   AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform Cla-2"
FT                   /note="P2.4 5'-UTR minus exon 8b; composed of exons 2a, 2b,
FT                   2c, 3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(AF333472.1:2872..3273,AF333473.1:222..329,
FT                   AF333474.1:86..164,AF333475.1:88..241,AF333476.1:96..206,
FT                   AF333477.1:239..351,AF333478.1:179..270,
FT                   AF333479.1:298..424,AF333481.1:174..327,
FT                   AF333482.1:185..245,AF333482.1:327..393,
FT                   AF333483.1:131..349,AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform C1a-1"
FT                   /note="P2.3 5'-UTR minus exon 8b; composed of exons 2a, 2b,
FT                   2c, 3a, 3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(AF333472.1:2872..2904,AF333472.1:3087..3273,
FT                   AF333474.1:86..164,AF333475.1:88..241,AF333476.1:96..206,
FT                   AF333477.1:239..351,AF333478.1:179..270,
FT                   AF333479.1:298..424,AF333481.1:174..327,
FT                   AF333482.1:185..245,AF333482.1:327..393,
FT                   AF333483.1:131..349,AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform Cla-2"
FT                   /note="P2.2 5'-UTR minus exon 8b; composed of exons 2a, 2c,
FT                   3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(AF333472.1:2872..2904,AF333472.1:3087..3273,
FT                   AF333473.1:222..329,AF333474.1:86..164,AF333475.1:88..241,
FT                   AF333476.1:96..206,AF333477.1:239..351,AF333478.1:179..270,
FT                   AF333479.1:298..424,AF333480.1:197..307,
FT                   AF333481.1:174..327,AF333482.1:185..245,
FT                   AF333482.1:327..393,AF333483.1:131..349,
FT                   AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform C1b-1"
FT                   /note="P2.1 5'-UTR plus exon 8b; composed of exons 2a, 2c,
FT                   3a, 3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(AF333472.1:2872..3273,AF333474.1:86..164,
FT                   AF333475.1:88..241,AF333476.1:96..206,AF333477.1:239..351,
FT                   AF333478.1:179..270,AF333479.1:298..424,
FT                   AF333480.1:197..307,AF333481.1:174..327,
FT                   AF333482.1:185..245,AF333482.1:327..393,
FT                   AF333483.1:131..349,AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform Clb-2"
FT                   /note="P2.4 5'-UTR plus exon 8b; composed of exons 2a, 2b,
FT                   2c, 3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   CDS             join(AF333473.1:307..329,AF333474.1:86..164,
FT                   AF333475.1:88..241,AF333476.1:96..206,AF333477.1:239..351,
FT                   AF333478.1:179..270,AF333479.1:298..424,
FT                   AF333480.1:197..307,AF333481.1:174..327,
FT                   AF333482.1:185..245,AF333482.1:327..393,
FT                   AF333483.1:131..349,AF333484.1:241..282,200..445)
FT                   /codon_start=1
FT                   /product="calcitonin receptor isoform Clb-1"
FT                   /note="composed of exons 3a, 3b, 4, 5, 6, 7, 8a, 8b, 9, 10,
FT                   11, 12, 13, and 14; alternatively spliced"
FT                   /db_xref="GOA:Q924D7"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="UniProtKB/TrEMBL:Q924D7"
FT                   /protein_id="AAK56133.1"
FT                   /translation="MTPRRSRVKRRNLRKPKMRFLLVNRFTLLLLLLVSPTPVLQAPTN
FT                   LTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPA
FT                   GATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAY
FT                   VLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEV
FT                   VPNGDLVRRDPMHIFHHNTHMWTMQWELSPPLPLCAHEGKMDPHASEVISCKVLHFLHQ
FT                   YMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYLLGWGFPIVPTIIHAITRALYYN
FT                   DNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKAT
FT                   MVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTLKR
FT                   QWTQFKIQWSQRWGRRRPTNRVVSAPRAVAFAEPDGLPIYICHQEPRNPPISNNEGEES
FT                   TEMIPMNVIQQDASA"
FT   CDS             join(AF333473.1:307..329,AF333474.1:86..164,
FT                   AF333475.1:88..241,AF333476.1:96..206,AF333477.1:239..351,
FT                   AF333478.1:179..270,AF333479.1:298..424,
FT                   AF333481.1:174..327,AF333482.1:185..245,
FT                   AF333482.1:327..393,AF333483.1:131..349,
FT                   AF333484.1:241..282,200..445)
FT                   /codon_start=1
FT                   /product="calcitonin receptor isoform Cla-1"
FT                   /note="composed of exons 3a, 3b, 4, 5, 6, 7, 8a, 9, 10, 11,
FT                   12, 13, and 14; alternatively spliced"
FT                   /db_xref="GOA:Q924D6"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="UniProtKB/TrEMBL:Q924D6"
FT                   /protein_id="AAK56132.1"
FT                   /translation="MTPRRSRVKRRNLRKPKMRFLLVNRFTLLLLLLVSPTPVLQAPTN
FT                   LTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPA
FT                   GATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAY
FT                   VLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEV
FT                   VPNGDLVRRDPISCKVLHFLHQYMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYL
FT                   LGWGFPIVPTIIHAITRALYYNDNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVL
FT                   VTKMRQTHEAESYMYLKAVKATMVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHF
FT                   QGFFVATIYCFCNHEVQVTLKRQWTQFKIQWSQRWGRRRPTNRVVSAPRAVAFAEPDGL
FT                   PIYICHQEPRNPPISNNEGEESTEMIPMNVIQQDASA"
FT   mRNA            join(AF333473.1:1019..1083,AF333474.1:86..164,
FT                   AF333475.1:88..241,AF333476.1:96..206,AF333477.1:239..351,
FT                   AF333478.1:179..270,AF333479.1:298..424,
FT                   AF333480.1:197..307,AF333481.1:174..327,
FT                   AF333482.1:185..245,AF333482.1:327..393,
FT                   AF333483.1:131..349,AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform C1b-2"
FT                   /note="P3.1 5'-UTR plus exon 8b; composed of exons 3b', 3b,
FT                   4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(AF333473.1:1019..1083,AF333474.1:86..164,
FT                   AF333475.1:88..241,AF333476.1:96..206,AF333477.1:239..351,
FT                   AF333478.1:179..270,AF333479.1:298..424,
FT                   AF333481.1:174..327,AF333482.1:185..245,
FT                   AF333482.1:327..393,AF333483.1:131..349,
FT                   AF333484.1:241..282,200..>2139)
FT                   /product="calcitonin receptor isoform Cla-2"
FT                   /note="P3.1 5'-UTR minus exon 8b; composed of exons 3b',
FT                   3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   CDS             join(AF333474.1:114..164,AF333475.1:88..241,
FT                   AF333476.1:96..206,AF333477.1:239..351,AF333478.1:179..270,
FT                   AF333479.1:298..424,AF333481.1:174..327,
FT                   AF333482.1:185..245,AF333482.1:327..393,
FT                   AF333483.1:131..349,AF333484.1:241..282,200..445)
FT                   /codon_start=1
FT                   /product="calcitonin receptor isoform Cla-2"
FT                   /note="composed of exons 3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12,
FT                   13, and 14; alternatively spliced"
FT                   /db_xref="GOA:Q924D5"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="UniProtKB/TrEMBL:Q924D5"
FT                   /protein_id="AAK56134.1"
FT                   /translation="MRFLLVNRFTLLLLLLVSPTPVLQAPTNLTDSGLDQEPFLYLVGR
FT                   KKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPAGATAYQHCPDYFPDFDT
FT                   AEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAYVLYYLALVGHSLSIAAL
FT                   VASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEVVPNGDLVRRDPISCKVL
FT                   HFLHQYMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYLLGWGFPIVPTIIHAITR
FT                   ALYYNDNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLK
FT                   AVKATMVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQ
FT                   VTLKRQWTQFKIQWSQRWGRRRPTNRVVSAPRAVAFAEPDGLPIYICHQEPRNPPISNN
FT                   EGEESTEMIPMNVIQQDASA"
FT   CDS             join(AF333474.1:114..164,AF333475.1:88..241,
FT                   AF333476.1:96..206,AF333477.1:239..351,AF333478.1:179..270,
FT                   AF333479.1:298..424,AF333480.1:197..307,
FT                   AF333481.1:174..327,AF333482.1:185..245,
FT                   AF333482.1:327..393,AF333483.1:131..349,
FT                   AF333484.1:241..282,200..445)
FT                   /codon_start=1
FT                   /product="calcitonin receptor isoform Clb-2"
FT                   /note="composed of exons 3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11,
FT                   12, 13, and 14; alternatively spliced"
FT                   /db_xref="GOA:Q790U4"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="UniProtKB/TrEMBL:Q790U4"
FT                   /protein_id="AAK56135.1"
FT                   /translation="MRFLLVNRFTLLLLLLVSPTPVLQAPTNLTDSGLDQEPFLYLVGR
FT                   KKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPAGATAYQHCPDYFPDFDT
FT                   AEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAYVLYYLALVGHSLSIAAL
FT                   VASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEVVPNGDLVRRDPMHIFHH
FT                   NTHMWTMQWELSPPLPLCAHEGKMDPHASEVISCKVLHFLHQYMMSCNYFWMLCEGIYL
FT                   HTLIVMAVFTDEQRLRWYYLLGWGFPIVPTIIHAITRALYYNDNCWLSAETHLLYIIHG
FT                   PVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKATMVLVPLLGIQFVVFPWR
FT                   PSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTLKRQWTQFKIQWSQRWGRRR
FT                   PTNRVVSAPRAVAFAEPDGLPIYICHQEPRNPPISNNEGEESTEMIPMNVIQQDASA"
FT   exon            200..>2139
FT                   /number=14
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   3'UTR           446..>2139
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
XX
SQ   Sequence 2139 BP; 647 A; 452 C; 409 G; 631 T; 0 other;
     aaacaagtaa ctcgatatct tgattagcat attgatattc ctagaaggtg tatttctttg        60
     cctcagtata aactcggttc ttagatcaga tctacaatgt aacctccatt cgcctctgat       120
     gagccccaaa agtcatgtac ataatttgct ggggtcattg cccacagtct atggaaacag       180
     gctctctttg ctcttgcagg tgcaagtcac cctgaagcgc cagtggacgc agttcaagat       240
     ccagtggagc caacgctggg gaaggcgccg ccccaccaac cgcgtagtta gtgctcctcg       300
     ggctgtagcc ttcgctgagc cagatggcct ccccatttac atctgccatc aggaaccacg       360
     gaatcctcca atcagcaaca acgaaggcga ggagagtact gaaatgatcc ccatgaacgt       420
     catccagcaa gacgcatccg cttgaatgtg aagccacccc aagcattgtg atccactgag       480
     ccttcatttc ctggggaaag acagaccatg tgtttcaagt gattcccatc ctcccaggag       540
     ctgaccatat catttgtgaa gaagtgttaa gtgaatttgt ccatagtgaa tttgaagaaa       600
     gtgattcttg gtactattgc tttgggagtc agtctaggaa tagagtctcc cattgcaact       660
     tgtgaactcc atcattcatc ctggactgag atgactgtgt tcgtaggaaa gcaggcaagg       720
     tgttcaaaag atgtcacact attgacctag ttcagataca gggtgctccc ttgtgaaatt       780
     ttgagccatt tgtaccgttg agaaattaaa atcactctca atgtttttaa atttgacact       840
     ggattttgaa ttagactatt tctgtatttg actacagatc tggtttttaa tgtttttatt       900
     tcagtcagtt cctatattac acatgttacc atccatacaa tgtcaactac acatatagca       960
     tgacctctga aagatggtgt gtcttttata acatgatcca gttcaccagg cagacccaaa      1020
     gtgctgtaat gaattgatct gaaccttgta tgtgctttgg tcactgacat ttataagttg      1080
     ggaggtcacc aagaacctat caccaaattt atcacaaaac tgccctccaa aatgtaacaa      1140
     tctttaaaga gagttttcac ttttcctaaa ctacaaggaa tttagtcaag agaccagagt      1200
     cactccaagg attataaaag caagattaac ctcttgccct tgggtgctat ctagcagtaa      1260
     gagaagattt gtttacgaac tggtaattaa agactcctat acaagtccat taactgcctt      1320
     ccacccagct tcaaagctaa acaagatccc tgtgttttca agaagactct gtgtggctaa      1380
     ttacaaatca gtttcttgtt gacctcttgc ttgctgctat tagcaaaaca agagggggaa      1440
     aaaacccaca atgtagggac ttcaaattta acctcatatt aattcatctt aaattaaaaa      1500
     cagagcttct catcaaaacc cagtactata tctccatacc catctcttta ctccccagta      1560
     ggagatcatc taagatccat gaataaacca ataccatcac agatttctga atctgcaaca      1620
     gtaaccagtc atcattactt aatttgtatg ctaaatgagg agcttttttg agaccctcaa      1680
     aatctcctgc tcacctttgt aatcttttgt cactgccttt cagaggtgat ttagttgtgt      1740
     aaagacaaaa gtaacttgat ttgttctggt tacatgcttg gtgtacccag agaaactgta      1800
     tttcaatagc aactgtggac cttggatact gagagttgcc tttaccaaaa tggaaggacg      1860
     gattgaagga aggatgtttt ttcaatcaca gtgttacctg gtgatgtccc tatgttttgt      1920
     ttacacacat cgaaatcagt gtatttcagg cagctctagt acaaatgtga taatatattg      1980
     aagtgtttga gatgttattg tgcttatgta gtaggagctg atgaaatcaa actgacttac      2040
     cataacattg catgtcatac ctaaattgtg ggaaacgctt ctgctgtgta catgtataaa      2100
     tacagagcat attaaaaagg caaaaaaaaa aaaaaaaaa                             2139
//


spacer
spacer