Dbfetch

ID   AH010783; SV 2; linear; genomic DNA; STD; MUS; 12969 BP.
XX
AC   AH010783; AF333472-AF333485;
XX
DT   08-APR-2016 (Rel. 128, Created)
DT   08-APR-2016 (Rel. 128, Last updated, Version 1)
XX
DE   Mus musculus strain 129 calcitonin receptor isoform C1b-1, calcitonin
DE   receptor isoform C1a-1, calcitonin receptor isoform C1b-1, and calcitonin
DE   receptor isoform C1a-1 genes, partial sequence; calcitonin receptor gene,
DE   complete cds, alternatively spliced; and calcitonin receptor isoform C1b-2
DE   gene, partial sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-12969
RX   DOI; 10.1074/jbc.M007104200.
RX   PUBMED; 11309373.
RA   Anusaksathien O., Laplace C., Li X., Ren Y., Peng L., Goldring S.R.,
RA   Galson D.L.;
RT   "Tissue-specific and ubiquitous promoters direct the expression of
RT   alternatively spliced transcripts from the calcitonin receptor gene";
RL   J Biol Chem 276(25):22663-22674(2001).
XX
RN   [2]
RP   1-12969
RA   Anusaksathien O., Li X., Ren Y., Laplace C., Goldring S.R., Galson D.L.;
RT   ;
RL   Submitted (04-JAN-2001) to the INSDC.
RL   New England Baptist Bone & Joint Institute, Beth Israel Deaconess Medical
RL   Center and Harvard Medical School, Harvard Institutes of Medicine, Rm247, 4
RL   Blackfan Circle, Boston, MA 02115, USA
XX
DR   MD5; ce85bd3a83ede7490a63af845d33bbf0.
XX
CC   On or before Apr 6, 2016 this sequence version replaced
CC   gi:14193777, gi:14193778, gi:14193779, gi:14193780, gi:14193781,
CC   gi:14193782, gi:14193783, gi:14193784, gi:14193785, gi:14193786,
CC   gi:14193787, gi:14193788, gi:14193789, gi:14193790, gi:14193776.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..12969
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /strain="129"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(1381..2062,3087..3273,3754..3861,4977..5055,
FT                   5497..5650,5934..6044,6463..6575,7017..7108,7506..7632,
FT                   8040..8150,8557..8710,9209..9269,9351..9417,9741..9959,
FT                   10504..10545,11030..>12969)
FT                   /product="calcitonin receptor isoform C1b-1"
FT                   /note="P1.1 5'-UTR plus exon 8b; composed of exons 1, 2c,
FT                   3a, 3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(1381..2062,3087..3273,3754..3861,4977..5055,
FT                   5497..5650,5934..6044,6463..6575,7017..7108,7506..7632,
FT                   8557..8710,9209..9269,9351..9417,9741..9959,10504..10545,
FT                   11030..>12969)
FT                   /product="calcitonin receptor isoform Cla-1"
FT                   /note="P1.1 5'-UTR minus exon 8b; composed of exons 1, 2c,
FT                   3a, 3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(1381..2062,3087..3273,4977..5055,5497..5650,
FT                   5934..6044,6463..6575,7017..7108,7506..7632,8040..8150,
FT                   8557..8710,9209..9269,9351..9417,9741..9959,10504..10545,
FT                   11030..>12969)
FT                   /product="calcitonin receptor isoform Clb-2"
FT                   /note="P1.2 5'-UTR plus exon 8b; composed of exons 1, 2c,
FT                   3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(1381..2062,3087..3273,4977..5055,5497..5650,
FT                   5934..6044,6463..6575,7017..7108,7506..7632,8557..8710,
FT                   9209..9269,9351..9417,9741..9959,10504..10545,
FT                   11030..>12969)
FT                   /product="calcitonin receptor isoform Cla-2"
FT                   /note="P1.2 5'-UTR minus exon 8b; composed of exons 1, 2c,
FT                   3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   exon            1381..2062
FT                   /number=1
FT                   /note="putative start of the P1 primary transcript; P1
FT                   primary transcript is 80764 bp in length"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          2063..3086
FT                   /number=1
FT                   /note="up to exon 2c"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   regulatory      2693..2871
FT                   /note="P2 promoter"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /regulatory_class="promoter"
FT   mRNA            join(2872..3273,3754..3861,4977..5055,5497..5650,
FT                   5934..6044,6463..6575,7017..7108,7506..7632,8040..8150,
FT                   8557..8710,9209..9269,9351..9417,9741..9959,10504..10545,
FT                   11030..>12969)
FT                   /product="calcitonin receptor isoform C1b-1"
FT                   /note="P2.3 5'-UTR plus exon 8b; composed of exons 2a, 2b,
FT                   2c, 3a, 3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(2872..3273,3754..3861,4977..5055,5497..5650,
FT                   5934..6044,6463..6575,7017..7108,7506..7632,8557..8710,
FT                   9209..9269,9351..9417,9741..9959,10504..10545,
FT                   11030..>12969)
FT                   /product="calcitonin receptor isoform C1a-1"
FT                   /note="P2.3 5'-UTR minus exon 8b; composed of exons 2a, 2b,
FT                   2c, 3a, 3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(2872..3273,4977..5055,5497..5650,5934..6044,
FT                   6463..6575,7017..7108,7506..7632,8040..8150,8557..8710,
FT                   9209..9269,9351..9417,9741..9959,10504..10545,
FT                   11030..>12969)
FT                   /product="calcitonin receptor isoform Clb-2"
FT                   /note="P2.4 5'-UTR plus exon 8b; composed of exons 2a, 2b,
FT                   2c, 3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(2872..3273,4977..5055,5497..5650,5934..6044,
FT                   6463..6575,7017..7108,7506..7632,8557..8710,9209..9269,
FT                   9351..9417,9741..9959,10504..10545,11030..>12969)
FT                   /product="calcitonin receptor isoform Cla-2"
FT                   /note="P2.4 5'-UTR minus exon 8b; composed of exons 2a, 2b,
FT                   2c, 3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(2872..2904,3087..3273,3754..3861,4977..5055,
FT                   5497..5650,5934..6044,6463..6575,7017..7108,7506..7632,
FT                   8040..8150,8557..8710,9209..9269,9351..9417,9741..9959,
FT                   10504..10545,11030..>12969)
FT                   /product="calcitonin receptor isoform C1b-1"
FT                   /note="P2.1 5'-UTR plus exon 8b; composed of exons 2a, 2c,
FT                   3a, 3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(2872..2904,3087..3273,3754..3861,4977..5055,
FT                   5497..5650,5934..6044,6463..6575,7017..7108,7506..7632,
FT                   8557..8710,9209..9269,9351..9417,9741..9959,10504..10545,
FT                   11030..>12969)
FT                   /product="calcitonin receptor isoform C1a-1"
FT                   /note="P2.1 5'-UTR minus exon 8b; composed of exons 2a, 2c,
FT                   3a, 3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(2872..2904,3087..3273,4977..5055,5497..5650,
FT                   5934..6044,6463..6575,7017..7108,7506..7632,8040..8150,
FT                   8557..8710,9209..9269,9351..9417,9741..9959,10504..10545,
FT                   11030..>12969)
FT                   /product="calcitonin receptor isoform Clb-2"
FT                   /note="P2.2 5'-UTR plus exon 8b; composed of exons 2a, 2c,
FT                   3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(2872..2904,3087..3273,4977..5055,5497..5650,
FT                   5934..6044,6463..6575,7017..7108,7506..7632,8557..8710,
FT                   9209..9269,9351..9417,9741..9959,10504..10545,
FT                   11030..>12969)
FT                   /product="calcitonin receptor isoform Cla-2"
FT                   /note="P2.2 5'-UTR minus exon 8b; composed of exons 2a, 2c,
FT                   3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   exon            2872..2904
FT                   /number=2a
FT                   /note="putative start of the P2 primary transcript;
FT                   contained within intron 1; P2 primary transcript is 79272
FT                   bp in length"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            2905..3086
FT                   /number=2b
FT                   /note="alternatively spliced from P2 transcripts, but part
FT                   of intron 1 in P1 transcripts"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            3087..3273
FT                   /number=2c
FT                   /note="utilized in mRNAs derived from both P1 and P2
FT                   transcripts"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          3274..>3432
FT                   /number=2c
FT                   /note="10.1 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             3433..3532
FT                   /estimated_length=unknown
FT   intron          <3533..3753
FT                   /number=2c
FT                   /note="10.1 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            3754..3861
FT                   /number=3a
FT                   /note="alternatively spliced from both P1 and P2
FT                   transcripts; contains the upstream translation start"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             join(3839..3861,4977..5055,5497..5650,5934..6044,
FT                   6463..6575,7017..7108,7506..7632,8040..8150,8557..8710,
FT                   9209..9269,9351..9417,9741..9959,10504..10545,11030..11275)
FT                   /codon_start=1
FT                   /product="calcitonin receptor isoform Clb-1"
FT                   /note="composed of exons 3a, 3b, 4, 5, 6, 7, 8a, 8b, 9, 10,
FT                   11, 12, 13, and 14; alternatively spliced"
FT                   /db_xref="GOA:Q924D7"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="UniProtKB/TrEMBL:Q924D7"
FT                   /protein_id="AAK56133.1"
FT                   /translation="MTPRRSRVKRRNLRKPKMRFLLVNRFTLLLLLLVSPTPVLQAPTN
FT                   LTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPA
FT                   GATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAY
FT                   VLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEV
FT                   VPNGDLVRRDPMHIFHHNTHMWTMQWELSPPLPLCAHEGKMDPHASEVISCKVLHFLHQ
FT                   YMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYLLGWGFPIVPTIIHAITRALYYN
FT                   DNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKAT
FT                   MVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTLKR
FT                   QWTQFKIQWSQRWGRRRPTNRVVSAPRAVAFAEPDGLPIYICHQEPRNPPISNNEGEES
FT                   TEMIPMNVIQQDASA"
FT   CDS             join(3839..3861,4977..5055,5497..5650,5934..6044,
FT                   6463..6575,7017..7108,7506..7632,8557..8710,9209..9269,
FT                   9351..9417,9741..9959,10504..10545,11030..11275)
FT                   /codon_start=1
FT                   /product="calcitonin receptor isoform Cla-1"
FT                   /note="composed of exons 3a, 3b, 4, 5, 6, 7, 8a, 9, 10, 11,
FT                   12, 13, and 14; alternatively spliced"
FT                   /db_xref="GOA:Q924D6"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="UniProtKB/TrEMBL:Q924D6"
FT                   /protein_id="AAK56132.1"
FT                   /translation="MTPRRSRVKRRNLRKPKMRFLLVNRFTLLLLLLVSPTPVLQAPTN
FT                   LTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPA
FT                   GATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAY
FT                   VLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEV
FT                   VPNGDLVRRDPISCKVLHFLHQYMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYL
FT                   LGWGFPIVPTIIHAITRALYYNDNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVL
FT                   VTKMRQTHEAESYMYLKAVKATMVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHF
FT                   QGFFVATIYCFCNHEVQVTLKRQWTQFKIQWSQRWGRRRPTNRVVSAPRAVAFAEPDGL
FT                   PIYICHQEPRNPPISNNEGEESTEMIPMNVIQQDASA"
FT   intron          3862..>4791
FT                   /number=3a
FT                   /note=">14.5 kbp (up to exon 3b)"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   regulatory      4232..4550
FT                   /note="P3 promoter"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /regulatory_class="promoter"
FT   mRNA            join(4551..4615,4977..5055,5497..5650,5934..6044,
FT                   6463..6575,7017..7108,7506..7632,8040..8150,8557..8710,
FT                   9209..9269,9351..9417,9741..9959,10504..10545,
FT                   11030..>12969)
FT                   /product="calcitonin receptor isoform C1b-2"
FT                   /note="P3.1 5'-UTR plus exon 8b; composed of exons 3b', 3b,
FT                   4, 5, 6, 7, 8a, 8b, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   mRNA            join(4551..4615,4977..5055,5497..5650,5934..6044,
FT                   6463..6575,7017..7108,7506..7632,8557..8710,9209..9269,
FT                   9351..9417,9741..9959,10504..10545,11030..>12969)
FT                   /product="calcitonin receptor isoform Cla-2"
FT                   /note="P3.1 5'-UTR minus exon 8b; composed of exons 3b',
FT                   3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12, 13, and 14;
FT                   alternatively spliced"
FT   exon            4551..4615
FT                   /number=3b'
FT                   /note="putative start of the P3 primary transcript;
FT                   contained within intron 3a; P3 primary transcript is 66530
FT                   bp in length"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             4792..4891
FT                   /estimated_length=unknown
FT   intron          <4892..4976
FT                   /number=3a
FT                   /note=">14.5 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            4977..5055
FT                   /number=3b
FT                   /note="utilized in mRNAs derived from all three primary
FT                   transcripts; contains the downstream translation start
FT                   utilized when exon 3a is absent"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             join(5005..5055,5497..5650,5934..6044,6463..6575,
FT                   7017..7108,7506..7632,8040..8150,8557..8710,9209..9269,
FT                   9351..9417,9741..9959,10504..10545,11030..11275)
FT                   /codon_start=1
FT                   /product="calcitonin receptor isoform Clb-2"
FT                   /note="composed of exons 3b, 4, 5, 6, 7, 8a, 8b, 9, 10, 11,
FT                   12, 13, and 14; alternatively spliced"
FT                   /db_xref="GOA:Q790U4"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="UniProtKB/TrEMBL:Q790U4"
FT                   /protein_id="AAK56135.1"
FT                   /translation="MRFLLVNRFTLLLLLLVSPTPVLQAPTNLTDSGLDQEPFLYLVGR
FT                   KKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPAGATAYQHCPDYFPDFDT
FT                   AEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAYVLYYLALVGHSLSIAAL
FT                   VASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEVVPNGDLVRRDPMHIFHH
FT                   NTHMWTMQWELSPPLPLCAHEGKMDPHASEVISCKVLHFLHQYMMSCNYFWMLCEGIYL
FT                   HTLIVMAVFTDEQRLRWYYLLGWGFPIVPTIIHAITRALYYNDNCWLSAETHLLYIIHG
FT                   PVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKATMVLVPLLGIQFVVFPWR
FT                   PSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTLKRQWTQFKIQWSQRWGRRR
FT                   PTNRVVSAPRAVAFAEPDGLPIYICHQEPRNPPISNNEGEESTEMIPMNVIQQDASA"
FT   CDS             join(5005..5055,5497..5650,5934..6044,6463..6575,
FT                   7017..7108,7506..7632,8557..8710,9209..9269,9351..9417,
FT                   9741..9959,10504..10545,11030..11275)
FT                   /codon_start=1
FT                   /product="calcitonin receptor isoform Cla-2"
FT                   /note="composed of exons 3b, 4, 5, 6, 7, 8a, 9, 10, 11, 12,
FT                   13, and 14; alternatively spliced"
FT                   /db_xref="GOA:Q924D5"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="UniProtKB/TrEMBL:Q924D5"
FT                   /protein_id="AAK56134.1"
FT                   /translation="MRFLLVNRFTLLLLLLVSPTPVLQAPTNLTDSGLDQEPFLYLVGR
FT                   KKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPAGATAYQHCPDYFPDFDT
FT                   AEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAYVLYYLALVGHSLSIAAL
FT                   VASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEVVPNGDLVRRDPISCKVL
FT                   HFLHQYMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYLLGWGFPIVPTIIHAITR
FT                   ALYYNDNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLK
FT                   AVKATMVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQ
FT                   VTLKRQWTQFKIQWSQRWGRRRPTNRVVSAPRAVAFAEPDGLPIYICHQEPRNPPISNN
FT                   EGEESTEMIPMNVIQQDASA"
FT   intron          5056..>5309
FT                   /number=3b
FT                   /note="4.3 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             5310..5409
FT                   /estimated_length=unknown
FT   intron          <5410..5496
FT                   /number=3b
FT                   /note="4.3 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            5497..5650
FT                   /number=4
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          5651..>5738
FT                   /number=4
FT                   /note="2.3 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             5739..5838
FT                   /estimated_length=unknown
FT   intron          <5839..5933
FT                   /number=4
FT                   /note="2.3 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            5934..6044
FT                   /number=5
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          6045..>6124
FT                   /number=5
FT                   /note="2.5 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             6125..6224
FT                   /estimated_length=unknown
FT   intron          <6225..6462
FT                   /number=5
FT                   /note="2.5 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            6463..6575
FT                   /number=6
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          6576..>6738
FT                   /number=6
FT                   /note="3.5 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             6739..6838
FT                   /estimated_length=unknown
FT   intron          <6839..7016
FT                   /number=6
FT                   /note="3.5 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            7017..7108
FT                   /number=7
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             7109..7208
FT                   /estimated_length=unknown
FT   intron          <7209..7505
FT                   /number=7
FT                   /note="3.2 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            7506..7632
FT                   /number=8a
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          7633..>7743
FT                   /number=8a
FT                   /note="1.1 kbp (up to exon 8b)"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             7744..7843
FT                   /estimated_length=unknown
FT   intron          <7844..8039
FT                   /number=8a
FT                   /note="1.1 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            8040..8150
FT                   /number=8b
FT                   /note="preferentially used in the brain; adds 37 amino
FT                   acids to extracellular domain 2; changes ligand
FT                   specificity; alternatively spliced"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          8151..>8283
FT                   /number=8b
FT                   /note="7 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             8284..8383
FT                   /estimated_length=unknown
FT   intron          <8384..8556
FT                   /number=8b
FT                   /note="7 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            8557..8710
FT                   /number=9
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          8711..>8924
FT                   /number=9
FT                   /note="6.5 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             8925..9024
FT                   /estimated_length=unknown
FT   intron          <9025..9208
FT                   /number=9
FT                   /note="6.5 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            9209..9269
FT                   /number=10
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          9270..9350
FT                   /number=10
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            9351..9417
FT                   /number=11
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          9418..>9510
FT                   /number=11
FT                   /note="1.1 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             9511..9610
FT                   /estimated_length=unknown
FT   intron          <9611..9740
FT                   /number=11
FT                   /note="1.1 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            9741..9959
FT                   /number=12
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          9960..>10163
FT                   /number=12
FT                   /note="1.2 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             10164..10263
FT                   /estimated_length=unknown
FT   intron          <10264..10503
FT                   /number=12
FT                   /note="1.2 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            10504..10545
FT                   /number=13
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   intron          10546..>10730
FT                   /number=13
FT                   /note="3.8 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   gap             10731..10830
FT                   /estimated_length=unknown
FT   intron          <10831..11029
FT                   /number=13
FT                   /note="3.8 kbp"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   exon            11030..>12969
FT                   /number=14
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   3'UTR           11276..>12969
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
XX
SQ   Sequence 12969 BP; 3273 A; 2593 C; 2362 G; 3431 T; 1310 other;
     ggtttatttg caaatatgag gcatcctgtt tgaaaagcag caacttaccn tgaatcaagg        60
     ttatgctacc tttgattata atccatctct ttactcagca gtccagcgca gacagtccaa       120
     tgtggaaatg agactgagct tctgaggaac cacacccata cttcccaaac atgctccact       180
     gtgctaggtt ccactccatt tcactacact gactttggaa caagcaacag atttcagaaa       240
     gtctagatca ccgggcaaac atacttttgc tatttcatgg cccccacatc cacagctttc       300
     catctgggga cttactgggt ccacacagaa aatattctgg aaccattaag acagcaacag       360
     agttagctac aattctgtga ttccaaacgc atctaacagg tgcatagcaa ttttggtatt       420
     aataaattaa tgtagcaagc aaagtcattt tattcccctt gagagactca gcctcatccc       480
     tgatccactc cagctacatc accttcccca aaatctggct atagtggctt cttgctttgc       540
     caaaattact tctggcacag ttagaacctc agttagttga agttgcctat gcttacacca       600
     cacatgcttt aaggctttat aacatacgtg tgctgtttcc tctatagttc ttagactttt       660
     cttatctaag tcgtgtacaa ctccgtggct ttacagaaac acgtccaatt tgctatcaga       720
     acactcctgt ttgttatcaa tactgtggat gcccaaggat cagtcaacaa caaccagttc       780
     ccctgtgctg gctggacagc aacactttct tcctcacacc agtcattccc cgactcactg       840
     atatttcagt gctttggagc tacaaaagaa taattctgga tatttggccc cccagcagtt       900
     gctatagtat atagtagata aattaacaat tttaataatt ctgtgccgtt tgtacccatg       960
     aaggcaatta aggttaccaa aaagaatttt taaaaagaag gtttgatcag ctgccggctg      1020
     gctagcagca gctggaaaat cagagagcta ctgaacccag gacagatgtt aaagcacaca      1080
     gccaggattt acatctaaat cgtgaattta gaggatctct tttgattttt tattagccca      1140
     aattaattgt acaaatagga aggttcacat acaggttttg tgcatgttgc tctgcatttt      1200
     tctttgctaa catccctctc acccgaatgt ctggcccctt gtcacatttc acacggccaa      1260
     ctattactgc cacttcaatc cagaaaatga aggggctaaa ggctcttccc ctgcagtgga      1320
     gtagtgcttt aggtttgatt gtatgagtct cactcggccc tcttggtcac ccggttgaag      1380
     gtgagaggga aaggcagaga gcaaatggag tagggggcct attaagacct attaagacct      1440
     attaagaccc ccatggaaat cgtacagctg acttgtcttc cactggggca ataaaagccc      1500
     caaactaaac agattagggg cccctatagt ctctctgcat ggaagagtcg agtaggggtt      1560
     caaattagga cagaagcaca tacacctttg cctgaagtca ctgacttcag gggcaaggga      1620
     tccaaggatg gatgaacaag gagaactgca gcccctttca caagacacct gaatctgtca      1680
     cccagaacta cccaaactca acctctgagt gcctaggaaa gtattttgtc ttgctctctg      1740
     acgcttcccc attctattat tactactttt tttttctggt gtgttagtca cctcgagggc      1800
     tacagccact ttgcattccc gggatacaca ggtaactgct tttcctggct tttgcttgaa      1860
     cagtcaggaa aagaagtgcc cgctgatgcc tggctgcacc cagctccgga taggaggtgg      1920
     aggatagccc gtccttggaa gcaacttgct ttcctcccag ggtgcgcctg ccagcccaga      1980
     ctgcgcccgc ctggaatcag attgtcccgg gctcctgctg gctttcagtg gagaagggga      2040
     attgtcctca acaccaagtc aggtaggtac ctcagactac tcttttctag ctgtgctcac      2100
     ttcggtcatt caccctaaga taataaacca gcaacaacct cttttgtgga gggcaatgtc      2160
     cccccaaatc caacctgcac cttaggttgc acctgcccaa atccaaaggg gtccagggct      2220
     tgctggaccc tctggttttt cttaccctct gcctccgggg tccttactca gcactccagg      2280
     tcttggtcag ctgttttctc acgctcccac cctaatttta ctgccgcgcc ccactacaga      2340
     ttccactctc catcgggtcc ctggtgcggt cacctgagtg accacgtttg gagccaggga      2400
     ccactctctt tggggtaggg ttctttggga aactcacctc cctacggaat tttcatcctc      2460
     cagggaaggg gttggactct cagaaagctg cctccaggga cgggttacga tcactgagcc      2520
     caatctgtcg accacccaac tccctcccta ctcaaggtct aactggggac cctctcccgc      2580
     ttcctggagc tccgagcgct ggggtgtggg gactcttggg gtgtggagca gcggcagcga      2640
     gtgcagaccc tctcccgctg gggcttgggg tccggaggag cacggagcgg ctgctagccc      2700
     ctccctccga gggctgaagg ggctgacgcg cagggagggt ccgggcgggg ccggctctga      2760
     gatcgtccgc tccccccacc accccccttg gccgcagcgc gtagggagga gggagcgggt      2820
     gacgcgcgca ccgaaaagga cttaagtcgg agaagtttgc gcacagcctt catctcggag      2880
     cgagcagcgg caggcactgc taaggtgagg ctcccgcgct ttggggagca gagcaaccgg      2940
     gaaaaggacc ttgcctggag cctattttgc tttgcagtct tgggctttaa acctacccca      3000
     taaaggaggc ttaaaggtct ggaaattgga aggtggacaa gaaggagtgc ttaggactaa      3060
     ttcagtttgc tctcacttta aactaggaga gccagccgcc caagactctg ggcggactgc      3120
     acctggctgg cttgcagaca actcttggtt ggagaggtgc ttacttctgc gcctcaccct      3180
     gccgttggca tcccctgcct gcagatgccc agtgaagtct gcgttcctga gaacacctga      3240
     gctgtgccca gacatccagc aagagaattc ctggtaagaa gaaggggttt tttccccctt      3300
     tcttttttct tttttggagg gaatgattgg aattaaagat gtggagtgtc ccaggaaaga      3360
     tgatagtgag aatgatactt tcgtcggatt ttttttttat attgcaaaat tgtagtttga      3420
     ctggttgata cannnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nngagaacta      3540
     attaagaact tgtaagcaac catgtataca aaatgcatat atttatatgc atatataagt      3600
     ataaagatat gcattttgta tacatatcag tattttgtaa aacatatcag taaaaataat      3660
     catgaaaaac atatctacca cttacataga acttactatg agccactaat gttgtgtgct      3720
     tttcactgat tttaatacat ttgatatttg cagcatccac ctaaggtaag tgccattaga      3780
     gcgccttcca gaggagaaga aaccgaggga gcagggctac tacacagagg atttgaaaat      3840
     gactccaagg aggtccagag tgtaagtaaa tcagaaaaga gacatgtact tactattaca      3900
     tttctgacgg ccaaagttca ttctcttaat gaaaaatatc tctcgctttg tattttgcat      3960
     gtcttgaagc agcagatcca tggatttctg tcttagaaaa tatatagaaa taataaaggg      4020
     tttccttatt gtaaatatct ttctctgaag ctgtcatgct tatacccagg tttatagtat      4080
     tccactgcaa actgagcttt accagggaaa agtgtgctct ccaagttgac aatttcattc      4140
     attaaaaaaa aaatcaagat catactgcaa acaagttgac ttattatttc aaattttcca      4200
     ttagaaatat tcaacacaac tcttaactgg accttaaaaa gaatcccaaa actacatttt      4260
     gcctctttcc atgagagcta gtcagaaacc catggtatct gtggttttaa tggtgtggag      4320
     gggaaaataa atgtatgagc ccaaaatggc aaatgaaaac acatcgaatt ttaattagtc      4380
     taaaaatgtc aattttccta ttcactcaga gatgataaac tttccaagct ctattttgga      4440
     acatgacagc tcatttccat gttccctgga catttcccta tctgatgact accttggtac      4500
     tctgtgtact tgggcaaaca gggggagggg ccaacaggag tgggactgtc catcctgaag      4560
     cccaaaggaa actgtgtgta agtccttcga gtgcattcag gctattcagt cttctgtaag      4620
     tggtttttat taattatgtc tgtgtttgtt tatttgctat atctacattt acattaattt      4680
     caccccttcc atttgcttgt cttacacatg tcttacattc tagtgtaaat catgtttaat      4740
     ctacaacttt ttttctctaa tggtacagat gaattttaga acagtaagag annnnnnnnn      4800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4860
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nccattgtat gtagtgcatc tggagaggga      4920
     acagggtaaa gatctgagag ctataccatt ttacatcttc attactcttt ttccaggaaa      4980
     aggcggaatc tccgcaaacc gaagatgagg ttccttctcg tgaacaggtt caccctgctg      5040
     ctcctgctcc tagtggtgag tgaagattgt tctgtttcct gttaatggtc atggagagta      5100
     gagaggagtg tctgagtgtg ggtgaactgg caactgaaag gaaaaccaaa actgggcttc      5160
     tccaaactgt cattcttctt aaggatgtga gaaatgtcca aaggatgttt gctcattttg      5220
     attattgtca taatttatcc gaacaattaa attccatttg tttggggaag ttcataataa      5280
     tttgtgtcag attcatagta cagacagccn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5340
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5400
     nnnnnnnnnt tttcataatt ttacaattat cacatttatt tatgtgttaa ttcattacct      5460
     actctctaag taactacctt tttacctttt atacagagcc caactccagt tcttcaggct      5520
     cctaccaatc tcactgactc cggccttgat caggagccat tcctgtactt ggttggccgc      5580
     aagaagctgc tggatgctca gtacaaatgc tatgaccgga ttcatcagtt gccctcttat      5640
     gaaggagaag gtaagagaaa ccatgtgaac ctatgtgtga agcatcattt aagcctgttt      5700
     cttcccaagg tacacatagt gctggatgat agctgaaann nnnnnnnnnn nnnnnnnnnn      5760
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5820
     nnnnnnnnnn nnnnnnnncc gcagcgatag gatccagcct ctctaaccac ctcagaaaca      5880
     ttctctttcc ttaagccaca tgtttcaatc ctagtttctt cctgaattcc caggtctgta      5940
     ctgcaaccgc acctgggatg gctggatgtg ctgggacgac actcccgctg gagccacagc      6000
     ctatcagcac tgccctgact acttcccgga ctttgacaca gcaggtaagc tctttggttt      6060
     cattttatgt ttttacgtta taaataaaaa tgtgtcaagt gaacaagcag acccaaatcc      6120
     acttnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnncccagg agtcatctat      6240
     agtgtgaata ggaatggtta ccatggtggt ctgagaaggc ccaacacttg gaatctctct      6300
     ttcagcctta aatgtctaag tgacaaaatg gttcatgtta tctctatgtt taagttcttt      6360
     ggggtgtgat tcactctcag gcacagcctg taagctttca gccatgactc ttcttgttgg      6420
     gatttgatgt actaatacgt taccattttg atccattaac agaaaaggtt tcaaaatact      6480
     gtgatgaaaa tggagagtgg tttagacacc ctgacagcaa ccgaacctgg tccaactata      6540
     ctctgtgcaa cgctttcact tctgagaaac tgcaagtaag ttctatttca aatctctgta      6600
     ttggataaga atgccactat ttatgcatga aaatggatgt aaaactgtaa aatatctgct      6660
     accccaaatc acaaaaaaca actaaactac tgacatataa cggacataac taaaaaaaaa      6720
     aaaaaaaaaa aaaaaaaann nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6780
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnaa      6840
     gcggatgggg catggtatgg ggagtttgtg gaggagaaac caggaagggg gacatttgaa      6900
     atgcaaataa aataaccagt aaaaagaaag acagaaagag agagagagag aagagagaga      6960
     gagaaattga agcttttgtt catctactta caagattttc caactctttc ttctagaatg      7020
     cgtacgttct ttattacctg gctcttgtgg gtcactcctt gtcgattgct gctttggttg      7080
     cttccatgct gatcttctgg attttcaann nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7200
     nnnnnnnncc tctatttaca tgtgaacatt aacattagca caatgtacaa gttaatgaag      7260
     gtagagaaga acccagtaca cacaaggtag gcaatggttt agccaaggca aaagaattta      7320
     ttggccatta aataactttc aatctcttac atttgttatt ggaagccacc atgagaaaca      7380
     aaaaccatga aatgccactg gaaaatgaat ttcaaagctt tcctctaaaa atctgaagta      7440
     ttaaaccatc tctccaagtt tatcgtgtaa caaccctttg tgctttcatg ttattttttc      7500
     cccaggaacc ttagctgcca gagggtgacc ttgcacaagc acatgttcct tacttatatt      7560
     ctgaattcta tcattatcat catccacctg gttgaggttg tgcccaatgg agatctggtg      7620
     cggcgggatc ctgtaagtac tatctgactt tgattttaat tttattgtaa agatcacagt      7680
     acctaaagat agcatgattc tagttgttga cttaaccagt ggtttaaagc ataatcacat      7740
     gaannnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnncatatag tttctagatg      7860
     tgctacacct ttagccaact gggtaaatag aaataatagc tagttgctat tcccatgatg      7920
     ctgaaggtca gttgctataa agtcagttaa ggaaacagtc taatgttgta attgtgcctg      7980
     taaaaccttg catatgacat tgccaatatt tgatcatgtt tgttctgaaa cattgacaga      8040
     tgcatatttt tcatcataac acacatatgt ggacaatgca gtgggaactg tcaccaccct      8100
     tacccctgtg tgcacacgag ggaaagatgg accctcatgc cagtgaagtg gtatgatgag      8160
     gattgaactt cagagactcg tgacttctgt ctccagacac aaccagcctg ggacaaaccc      8220
     acaaagggcg gggtgtgggg nnggggtttg ttttctcgta attcattctc atcggctagt      8280
     ttgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      8340
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnncgtgtac tctcacactg      8400
     tccctttaat ttgtaaatgt agagggcaca tgttgacaaa tactcagagt gattcttgag      8460
     agttcaatgc acacactttg gctcatcaat gcactctttc tccaaccaca tcttcaacaa      8520
     tgscttcnat tcagcatctt tatttctttc taacagataa gttgcaaggt tctacacttt      8580
     ttacatcagt acatgatgtc ttgcaactac ttctggatgc tctgcgaggg gatctatctt      8640
     catactctga ttgtcatggc tgtgtttacc gacgagcaac gcctacgctg gtactatctt      8700
     cttggctggg gtatgtattt caaacagcta gattctgagg agctagggac ccatcttttc      8760
     atatttgcat ctttgcatat ttatatcctt cttccagtct tgatttagaa agacacactc      8820
     agaattctag tcacttgaag aacttccctc acatatttct ttcaagtcta gtttacttat      8880
     ttcatttgaa atacaattga tggaatttct tgtacgagtt caaannnnnn nnnnnnnnnn      8940
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9000
     nnnnnnnnnn nnnnnnnnnn nnnncttgag ccaggngcaa ttctttctgc atggccaaag      9060
     atcacttgtc tacaaacatc agaggaatgt cttgataggt atcctcaatt tgcaaccatc      9120
     tttgcaaaaa tgccccnatt atctatgcaa tcttagttaa gcttatggca tgggggnnaa      9180
     gtttgatttg tgcttttccc aattttaggg ttcccgatag tgccaaccat tatccacgcc      9240
     atcactcgtg ccctctacta caacgacaag taagtatcag gttggttttt aataggatac      9300
     tccaaagaaa gagcacattt gtactgatat gaacccttgc ttttcttcag ctgctggctg      9360
     agtgcagaaa cccacttgct ttacatcatc catggacccg tcatggtggc tctggtggtg      9420
     agaactgatt tttaaatata ttgctctaag tgtcattgcc caaatttgtg aatacattta      9480
     tatgtggcac atgtactgca actacaagat nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9600
     nnnnnnnnnn gagccaaaaa ttagatgtgg ttcagatgtc aacttctttt atttttaaaa      9660
     gttctctagt cctcgatcta gtagatatag tattgtccac accacagaaa tgaatccttc      9720
     accaatctga ctctctgcag gtcaacttct tctttcttct caacattgtc cgcgtgcttg      9780
     tgaccaagat gaggcaaacc cacgaggccg agtcctacat gtacctgaag gctgtgaagg      9840
     ccaccatggt ccttgtgccc ctgctgggga tccagtttgt tgtgtttccc tggaggccct      9900
     ccaacaaggt gcttgggaag atctatgatt atctcatgca ctctctgatt catttccagg      9960
     taaggaaacc aaccccatgt ttacttgatg gcttattctc ctgttacgtc aatctgacta     10020
     aaacccagaa cattccttat aagattatga tcttaggagt caaaatgcat agccttaact     10080
     gagtagaccc aaccaaaaat tttgaaggaa atagggtttt taaaggcatt tttttctact     10140
     ttattgatac ataggccccc tttnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     10200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     10260
     nnncgatgtg tttaataacc taagctactg ggntcatact tacaacttag cacaaggcat     10320
     tgtatgagct taagcaagac cccctagaca actaaattca ggcttctgag agacatagtt     10380
     ggaacagttc ctcactaatt cacagtccac agtttcaccc tcagacttgc aaaagattct     10440
     tctgatgacc acagcttttt aattttttaa atttaattag catatgtttc cttctctttt     10500
     tagggattct ttgtggcgac tatctactgc ttctgcaacc atgaggtaag catgtgtttc     10560
     acataataat atcatccacg tatataaagc cagcctttta cgttttctaa aggaccacag     10620
     tgcaatttca tcagatctca tttcaatatg ctctcatagg ggattgtgag taatggtgta     10680
     ctggtggtta tcccactacc tcaagcagaa tcacactcac ctattggatg nnnnnnnnnn     10740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     10800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn aaacaagtaa ctcgatatct tgattagcat     10860
     attgatattc ctagaaggtg tatttctttg cctcagtata aactcggttc ttagatcaga     10920
     tctacaatgt aacctccatt cgcctctgat gagccccaaa agtcatgtac ataatttgct     10980
     ggggtcattg cccacagtct atggaaacag gctctctttg ctcttgcagg tgcaagtcac     11040
     cctgaagcgc cagtggacgc agttcaagat ccagtggagc caacgctggg gaaggcgccg     11100
     ccccaccaac cgcgtagtta gtgctcctcg ggctgtagcc ttcgctgagc cagatggcct     11160
     ccccatttac atctgccatc aggaaccacg gaatcctcca atcagcaaca acgaaggcga     11220
     ggagagtact gaaatgatcc ccatgaacgt catccagcaa gacgcatccg cttgaatgtg     11280
     aagccacccc aagcattgtg atccactgag ccttcatttc ctggggaaag acagaccatg     11340
     tgtttcaagt gattcccatc ctcccaggag ctgaccatat catttgtgaa gaagtgttaa     11400
     gtgaatttgt ccatagtgaa tttgaagaaa gtgattcttg gtactattgc tttgggagtc     11460
     agtctaggaa tagagtctcc cattgcaact tgtgaactcc atcattcatc ctggactgag     11520
     atgactgtgt tcgtaggaaa gcaggcaagg tgttcaaaag atgtcacact attgacctag     11580
     ttcagataca gggtgctccc ttgtgaaatt ttgagccatt tgtaccgttg agaaattaaa     11640
     atcactctca atgtttttaa atttgacact ggattttgaa ttagactatt tctgtatttg     11700
     actacagatc tggtttttaa tgtttttatt tcagtcagtt cctatattac acatgttacc     11760
     atccatacaa tgtcaactac acatatagca tgacctctga aagatggtgt gtcttttata     11820
     acatgatcca gttcaccagg cagacccaaa gtgctgtaat gaattgatct gaaccttgta     11880
     tgtgctttgg tcactgacat ttataagttg ggaggtcacc aagaacctat caccaaattt     11940
     atcacaaaac tgccctccaa aatgtaacaa tctttaaaga gagttttcac ttttcctaaa     12000
     ctacaaggaa tttagtcaag agaccagagt cactccaagg attataaaag caagattaac     12060
     ctcttgccct tgggtgctat ctagcagtaa gagaagattt gtttacgaac tggtaattaa     12120
     agactcctat acaagtccat taactgcctt ccacccagct tcaaagctaa acaagatccc     12180
     tgtgttttca agaagactct gtgtggctaa ttacaaatca gtttcttgtt gacctcttgc     12240
     ttgctgctat tagcaaaaca agagggggaa aaaacccaca atgtagggac ttcaaattta     12300
     acctcatatt aattcatctt aaattaaaaa cagagcttct catcaaaacc cagtactata     12360
     tctccatacc catctcttta ctccccagta ggagatcatc taagatccat gaataaacca     12420
     ataccatcac agatttctga atctgcaaca gtaaccagtc atcattactt aatttgtatg     12480
     ctaaatgagg agcttttttg agaccctcaa aatctcctgc tcacctttgt aatcttttgt     12540
     cactgccttt cagaggtgat ttagttgtgt aaagacaaaa gtaacttgat ttgttctggt     12600
     tacatgcttg gtgtacccag agaaactgta tttcaatagc aactgtggac cttggatact     12660
     gagagttgcc tttaccaaaa tggaaggacg gattgaagga aggatgtttt ttcaatcaca     12720
     gtgttacctg gtgatgtccc tatgttttgt ttacacacat cgaaatcagt gtatttcagg     12780
     cagctctagt acaaatgtga taatatattg aagtgtttga gatgttattg tgcttatgta     12840
     gtaggagctg atgaaatcaa actgacttac cataacattg catgtcatac ctaaattgtg     12900
     ggaaacgctt ctgctgtgta catgtataaa tacagagcat attaaaaagg caaaaaaaaa     12960
     aaaaaaaaa                                                             12969
//