spacer

EBI Dbfetch

ID   AF330103; SV 1; linear; genomic DNA; STD; HUM; 285 BP.
XX
AC   AF330103;
XX
DT   15-FEB-2001 (Rel. 66, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-285
RA   Hurley C., Tang T., Li L.;
RT   "Human Leukocyte Antigen Class II DRB1*0804 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-285
RA   Hurley C., Tang T., Li L.;
RT   ;
RL   Submitted (19-DEC-2000) to the INSDC.
RL   Microbiology & Immunology, Georgetown University, 3970 Reservoir Rd. NW,
RL   Washington D.C. 20087, USA
XX
DR   MD5; 8128da860d0e947a9b9a755a64d46fb2.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..285
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="NT0016"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="whole blood"
FT                   /note="identical sequence found in isolates NT0017,NT0018"
FT                   /db_xref="taxon:9606"
FT   exon            13..282
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   mRNA            <13..>282
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <13..>282
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q30134"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*08:04:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30134"
FT                   /protein_id="AAK08504.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDFLEDRRALVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 285 BP; 59 A; 67 C; 103 G; 56 T; 0 other;
     gtgtccccac agcacgtttc ttggagtact ctacgggtga gtgttatttc ttcaatggga        60
     cggagcgggt gcggttcctg gacagatact tctataacca agaggagtac gtgcgcttcg       120
     acagcgacgt gggggagtac cgggcggtga cggagctggg gcggcctgat gccgagtact       180
     ggaacagcca gaaggacttc ctggaagaca ggcgggccct ggtggacacc tactgcagac       240
     acaactacgg ggttgtggag agcttcacgg tgcagcggcg aggtg                       285
//


spacer
spacer