Dbfetch

ID   AF325345; SV 1; linear; mRNA; STD; MUS; 249 BP.
XX
AC   AF325345;
XX
DT   05-DEC-2001 (Rel. 70, Created)
DT   16-DEC-2008 (Rel. 98, Last updated, Version 3)
XX
DE   Mus musculus nicotinic acetylcholine receptor alpha 2 subunit mRNA, partial
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-249
RX   DOI; 10.1016/S0165-5728(02)00220-5.
RX   PUBMED; 12225896.
RA   Kuo Y.-P., Lucero L., Michaels J., DeLuca D., Lukas R.L.;
RT   "Differential expression of nicotinic acetylcholine receptor subunits in
RT   fetal and neonatal mouse thymus";
RL   J. Neuroimmunol. 130(1-2):140-154(2002).
XX
RN   [2]
RP   1-249
RA   Kuo Y.-P., Lukas R.J.;
RT   ;
RL   Submitted (01-DEC-2000) to the INSDC.
RL   Neurobiology, Barrow Neurological Institute, 350 West Thomas Road, Phoenix,
RL   AZ 85013, USA
XX
DR   MD5; 3fa488b25d1ed0306deea486691eed05.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..249
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>249
FT                   /codon_start=3
FT                   /product="nicotinic acetylcholine receptor alpha 2 subunit"
FT                   /db_xref="MGI:MGI:87886"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VI12"
FT                   /protein_id="AAL37361.1"
FT                   /translation="NRPLPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEEEED
FT                   ENICMCAGLPDSSMGVLYGHGSLHLRAMGPEAKTPSQ"
XX
SQ   Sequence 249 BP; 62 A; 66 C; 76 G; 45 T; 0 other;
     ctaatcggcc cctgccgccc atggagctcc atggctctcc aggtctgaag ctcagcccca        60
     cttatcattg gctggagacc aacatggatg ctgaagaaag ggaggagaca gaggaagagg       120
     aggaggagga agaagatgaa aacatatgta tgtgtgcagg cctcccagac tcttccatgg       180
     gtgtcctcta tggccatggc agcctgcatc tgagggccat ggggcctgag gccaagactc       240
     catcccagg                                                               249
//