Dbfetch

ID   AF320126; SV 2; linear; mRNA; STD; MUS; 4237 BP.
XX
AC   AF320126;
XX
DT   21-DEC-2000 (Rel. 66, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus metabotropic glutamate receptor type 1 (Glur1) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4237
RX   DOI; 10.1016/S0169-328X(99)00239-9.
RX   PUBMED; 10581402.
RA   Zhu H., Ryan K., Chen S.;
RT   "Cloning of novel splice variants of mouse mGluR1";
RL   Brain Res. Mol. Brain Res. 73(1-2):93-103(1999).
XX
RN   [2]
RP   1-4237
RA   Zhu H., Ryan K., Chen S.;
RT   ;
RL   Submitted (08-NOV-2000) to the INSDC.
RL   Laboratory for Cancer Research, Rutgers University, 164 Frelinghuysen Rd.,
RL   Piscataway, NJ 08854-8020, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-4237
RA   Zhu H., Ryan K., Chen S.;
RT   ;
RL   Submitted (12-JUL-2001) to the INSDC.
RL   Laboratory for Cancer Research, Rutgers University, 164 Frelinghuysen Rd.,
RL   Piscataway, NJ 08854-8020, USA
XX
DR   MD5; 8f139bc6f20732bc289a69b2f60e3ff4.
DR   Ensembl-Gn; ENSMUSG00000019828; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017011; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016989; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016953; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016947; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016772; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017409; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016354; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016744; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016852; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016847; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016927; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016877; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017447; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016139; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016416; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000044306; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105560; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105561; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0024565; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0024531; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0024500; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0024501; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0024311; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025011; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0023854; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0024240; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0024364; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0024364; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0024482; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0024353; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025050; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0023563; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0023867; mus_musculus_wsbeij.
XX
CC   On Jul 12, 2001 this sequence version replaced gi:11935151.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4237
FT                   /organism="Mus musculus"
FT                   /strain="ICR"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             427..4026
FT                   /codon_start=1
FT                   /gene="Glur1"
FT                   /product="metabotropic glutamate receptor type 1"
FT                   /db_xref="GOA:P97772"
FT                   /db_xref="InterPro:IPR000162"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001256"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR017979"
FT                   /db_xref="InterPro:IPR019588"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1351338"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97772"
FT                   /protein_id="AAG41991.2"
FT                   /translation="MVRLLLIFFPMIFLEMSILPRMPDRKVLLAGASSQRSVARMDGDV
FT                   IIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSE
FT                   IRDSCWHSSVALEQSIEFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPG
FT                   SSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRY
FT                   NWTYVSAVHTEGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERL
FT                   PKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITI
FT                   KLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNES
FT                   LEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGYVGLCDAMKPIDGRKLLDFLIKSS
FT                   FVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKS
FT                   GMVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEFVQDEFTCRACDLGWWPNAELT
FT                   GCEPITIRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIIL
FT                   AGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKIC
FT                   TRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGV
FT                   VAPVGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKI
FT                   ITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGKLPCRSNT
FT                   FLNIFRRKKPGAGNANSNGKSVSWSEPGGRQAPKGQHVWQRLSVHVKTNETACNQTAVI
FT                   KPLTKSYQGSGKSLTFSDASTKTLYNVEEEDNTPSTHFSPPSSPSMVVHRRGPPVATTP
FT                   PLPPHLSAEETPLFLADSVIPKGLPPPLPQQQQQPPPQPPPQQPKSLMDQLQGVVTNFG
FT                   SGIPDFHAVLAGPGTPGNGLRSLYPPPPPPQHLQMLPLQLSTFREEPISPPGEDDDDDS
FT                   SERFKLLQEFVYEREGNTEEDDLEEEEDLPAASKLTPEDSPALTPPSPFRDSVASGSSV
FT                   PSSPVSESVLCTPPNVTYASVILRDYKQSSSTL"
XX
SQ   Sequence 4237 BP; 1027 A; 1150 C; 1155 G; 905 T; 0 other;
     cccagatggc agccttgcac cgtctgattt ggagctgagg tgtctgcgaa ccgagggcgg        60
     ctgcagtcct ctgacctgag accaatagct ctgtctaccc ggactcagcg tccagcttat       120
     ggccactaac gcgccgctca ttgcacacct gattcacaca ccttcgggca ccagtgaaaa       180
     aaccgcgact tgattttctg gaagaacacc cctagggttt gggagcggtc gtggaggacc       240
     agcaggaaga agcggagggg agaggggcgg tggtggagac tgagaagctt tgaaccagct       300
     gtgttggcca aaggcacgaa gcggcaaaag acagcggcgg gcgtcagggt ggttcgcgct       360
     gggaacctgc aggcgggacc ggcgtgggaa cgtggcttgc cggcggtcga ccgcgtcttc       420
     gccacaatgg tccggctcct cttgattttc ttcccaatga tctttttgga gatgtccatt       480
     ttgcccagga tgcctgacag aaaagtactg ctggcaggtg cctcgtccca gcgctctgtg       540
     gcgagaatgg acggagatgt catcatcgga gccctcttct cagtccatca ccagcctcca       600
     gccgaaaagg taccggaaag gaagtgtggg gagatcagag aacagtatgg tatccagaga       660
     gtggaggcca tgttccacac attagataag attaatgcgg acccggtgct cctgcccaac       720
     atcactctgg gcagtgagat ccgggactcc tgctggcact cttctgtggc tctggaacag       780
     agcattgagt tcatcagaga ctccctgatt tccatccgag atgagaagga tggactgaac       840
     cgctgcctgc ctgatggcca gaccctaccc ccaggcagga ctaagaagcc tattgctgga       900
     gtgatcggcc ctggctccag ctctgtggcc attcaagtcc agaatcttct gcagctgttc       960
     gacatcccac aaatcgccta ttctgccacg agcatagacc tgagcgacaa aactttgtac      1020
     aaatacttcc tgagggtggt cccttctgac actttgcagg caagggcgat gcttgatatc      1080
     gtcaagcggt acaactggac ctatgtctct gcagtccaca cagaagggaa ttacggcgag      1140
     agtggaatgg atgctttcaa agagttggct gcccaggaag gactctgcat cgcacactcg      1200
     gacaaaatct acagcaatgc tggcgagaag agctttgatc ggcttctgcg caagctccga      1260
     gagcggcttc ccaaggccag ggttgtggtc tgcttctgcg agggcatgac agtgcggggg      1320
     ttactgagtg ccatgcgccg ccttggcgtc gtgggagagt tctcactcat tggaagtgat      1380
     ggatgggcag acagagatga agtcatcgaa ggctatgagg tggaagccaa tgggggaatc      1440
     acaataaagc tgcagtctcc agaggtcagg tcgtttgatg actactttct gaagctgagg      1500
     ctggacacca acacgaggaa tccttggttc cctgagttct ggcaacatcg cttccagtgt      1560
     cgcctacctg gacacctctt ggaaaacccc aactttaaaa aagtctgcac aggaaatgaa      1620
     agcttggaag aaaattatgt ccaggacagc aaaatgggat ttgtcatcaa cgccatctat      1680
     gccatggcac acggcctaca gaacatgcac catgctctat gtcctggcta cgtgggcctt      1740
     tgtgatgcca tgaagcccat tgacggcagg aagctcctgg atttcctcat caaatcctct      1800
     tttgttggag tgtctggaga ggaggtctgg ttcgatgaga agggggatgc acctggaagg      1860
     tatgacatta tgaatctgca gtacacagag gctaatcgct atgactatgt ccatgtggga      1920
     acctggcatg aaggtgtgct gaatatcgat gattacaaaa tccagatgaa caaaagcgga      1980
     atggtacgat ctgtgtgcag cgagccttgc ttaaagggtc agattaaggt catacggaaa      2040
     ggggaagtga gctgctgctg gatctgcaca gcctgcaaag agaatgagtt tgtgcaagat      2100
     gagtttacct gcagagcctg tgacctgggg tggtggccca atgcagagct cacaggctgt      2160
     gagcccatta ctatccgtta cctcgagtgg agtgacatag aatccatcat agccatcgcc      2220
     ttttcttgcc tgggcatcct cgtgacgcta tttgtcaccc tcatctttgt gctgtaccgg      2280
     gacacacctg tggtcaaatc ctccagtaga gagctctgct atatcattct ggctggtatt      2340
     ttcctcggct acgtatgccc tttcaccctc atcgccaaac ctactaccac atcctgctac      2400
     ctccagcgcc tcctagttgg cctctcttct gccatgtgct actctgctct tgtgaccaaa      2460
     accaatcgta ttgcacgcat cctggctggc agcaagaaga agatctgtac ccggaagccc      2520
     aggttcatga gcgcttgggc ccaagtgatc atagcctcca ttctgattag tgtacagctg      2580
     acactagtgg tgaccttgat catcatggag cctcccatgc ccattttgtc ctacccgagc      2640
     atcaaggaag tctatcttat ctgcaatacc agcaacctgg gtgtagtggc acctgtgggt      2700
     tacaacggac ttctcatcat gagctgtacc tactatgcct tcaagacccg caacgtgccg      2760
     gccaatttca atgaggctaa atacatcgcc ttcactatgt acaccacctg catcatctgg      2820
     ctggcttttg ttcccattta ctttgggagc aactacaaga ttatcactac ctgcttcgca      2880
     gtgagcctca gtgtgacggt ggccctgggc tgcatgttca ctcccaagat gtacatcatt      2940
     attgccaaac ccgagaggaa tgtccgcagt gccttcacca cctctgatgt agtgcgcatg      3000
     cacgtcggtg acggcaagct gccatgccgc tccaacacct tcctcaacat tttccggaga      3060
     aagaagcctg gggcagggaa cgccaattct aacggcaagt ctgtgtcatg gtctgaacca      3120
     ggtggaagac aggcgcccaa gggacagcat gtgtggcagc gcctctctgt gcacgtgaag      3180
     accaatgaga cggcctgtaa ccaaacagcc gtaattaaac ccctcactaa aagttaccaa      3240
     ggctctggca agagtctgac cttttcagac gccagcacca agacccttta caacgtggag      3300
     gaagaggaca ataccccttc aactcacttc agccctccca gcagcccttc catggtggtg      3360
     caccgacgcg ggccacccgt ggccaccacg ccacctctgc caccccacct tagcgcagaa      3420
     gagacgccct tgttcctggc tgattctgtc atccccaagg gcttgcctcc tcctctcccg      3480
     cagcagcaac agcagccgcc ccctcagccg cctccgcagc agcccaaatc cctgatggac      3540
     cagctgcaag gcgtggtcac caactttggc tctgggattc cagacttcca cgcggtgctg      3600
     gcaggcccgg ggacaccagg gaacgggctg cgctccctgt acccgccccc gcctccaccg      3660
     caacacctgc agatgttgcc cctgcagctg agcaccttcc gagaggagcc catctcccct      3720
     ccgggggagg acgacgatga tgacagcagc gagaggttca agctcctgca ggagttcgtg      3780
     tatgagcgtg aagggaacac ggaggaagac gatctggaag aggaggagga cctgcctgca      3840
     gccagcaagc tgacgcctga ggattcgcct gccctgacgc ccccttctcc tttccgagat      3900
     tccgtggcct ctggcagctc agtgcccagt tccccagtgt ctgagtcagt gctctgcacc      3960
     cctccaaatg tgacctatgc ctctgtcatt ctgagggact acaagcaaag ctcttccact      4020
     ctgtagtaag gggggagtat gcgtggagaa gccagagatg ccaaggagtg tcaacccttt      4080
     cagaaatgtg tagaaagcaa gggggtgggg tgggatggag gaccacagtc tgcagggaag      4140
     aaaaaaaaga aaagaaaagg aaaggaaagg aaaggaaagg aaaggaaagg aaaggaaagg      4200
     aaaggaaagg aaaggaaagg aaaggaaagg aaaaaaa                               4237
//