spacer

EBI Dbfetch

ID   AF319951; SV 1; linear; mRNA; STD; MUS; 2447 BP.
XX
AC   AF319951;
XX
DT   05-DEC-2001 (Rel. 70, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus cation-chloride cotransporter mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2447
RA   Mount D.B.;
RT   "Cloning and characterization of mouse CCC9 (SLC12A9), a new member of the
RT   cation-chloride cotransporter gene family";
RL   Unpublished.
XX
RN   [2]
RP   1-2447
RA   Mount D.B.;
RT   ;
RL   Submitted (07-NOV-2000) to the INSDC.
RL   Medicine, Vanderbilt University Medical Center, S-3223 Medical Center
RL   North, VUMC, Nashville, TN 37232-2372, USA
XX
DR   MD5; b489a73e1b9cbc228fdfad87dda7b2c2.
DR   Ensembl-Gn; ENSMUSG00000035506; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059056; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121925; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2447
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..2112
FT                   /codon_start=1
FT                   /product="cation-chloride cotransporter"
FT                   /note="CCC9"
FT                   /db_xref="GOA:Q8VI23"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="MGI:MGI:2443672"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VI23"
FT                   /protein_id="AAL37178.1"
FT                   /translation="MSQVQELFHEAAQQGILAQPQPWWKIQLFMWEPVLFGTWDGVFTS
FT                   CMINIFGVVLFLRTGWLVGNTGVLLGLLLVSFVVLVALITVLSGIGVAEHGGISSGGVY
FT                   SMISSVLGGQMGGTVGLLYVFGQCVAGAMYITGFAESISDLLGLGDIWAVRGISVAVLL
FT                   ALLGINLAGVKWIIRLQPLLLLLLAVSTLDFVVGSFTHLDPEHGFIGYSPELLQSNILP
FT                   EYSPGESFFTVLGVFFPAATGVMAGFNMGGDLRDPADSVPLGSLAAVGVSWFLYIIFAF
FT                   LLGAVCTREALRSDFLIAEKVSLVGFLFLLGLYISSLASCMGGLYGAPRILQCIAQDKV
FT                   IPALAFLANGKGPNKTPVAAICLTSLVTMAFVLVGQVNVLAPVVTINFMLTYIMVDYSY
FT                   FALSMAHCGLAPSPEPVPRQGPDTLHCSEHLLQDRAPSYGSDVPARSLSEGTLLEFTKD
FT                   MDQFLQPIEELESRQLGSREGNNPKNQKRKGKKGAKQTLQDSFLLDPGSPLSFPTRTSE
FT                   RLSVAFCGEQESYQKQQTSRSESHDHLVPDLRNQPRVNREDFFLKCRLQEQEIQRRPSV
FT                   FYACMCNPWVSLLGALASLLIMFVIQWLYTLASMGVAALVYFYIGQASPGLYLGSASNF
FT                   SFFQWMKSFLVPSCRSLRSAQEQIILAPSPAKVDMAMTQLTQDNADFATRDRYHHSSFL
FT                   SREQLMPPY"
XX
SQ   Sequence 2447 BP; 518 A; 685 C; 632 G; 612 T; 0 other;
     atgtctcaag tgcaggaact cttccacgaa gcagcccagc agggcatcct ggcccagccc        60
     cagccctggt ggaagatcca gctgttcatg tgggagccgg tgctgtttgg gacctgggat       120
     ggtgtgttca catcctgcat gatcaacatt tttggcgttg tccttttctt gaggaccggc       180
     tggctggtgg gaaacacagg tgtgctcctg ggcttgctcc tggtgtcctt cgtcgtcctc       240
     gtggccctca tcaccgtgct gtcgggcatt ggtgtcgcag agcatggcgg gatcagcagt       300
     ggcggtgtct actccatgat ctcctcggtg cttggtgggc agatgggagg cactgtgggg       360
     ctgctctatg tatttggaca gtgtgttgca ggtgctatgt acatcaccgg ctttgcggag       420
     tccatctcag atctgctggg acttggggac atctgggcag tgcgtggaat ttcagttgct       480
     gtgcttctgg ctttgctggg catcaacctg gcaggtgtca agtggattat ccgcctccag       540
     ccgctgctgc tgctcctgct ggctgtctcg accctggact ttgtggtggg ctctttcacc       600
     cacctggacc cagaacatgg ctttattggc tactccccag aactgctaca gagcaacatt       660
     ctgccagagt acagccccgg ggagtcattc ttcactgtgt taggggtgtt cttccctgca       720
     gctacaggag tcatggctgg cttcaacatg ggaggagacc tgagagaccc tgctgacagt       780
     gtccccttag gctccctagc agctgttggc gtctcgtggt ttctctacat catctttgcc       840
     ttcctgcttg gtgccgtctg tacccgagag gccctccgct ctgacttcct gatagctgaa       900
     aaggtgtctc tggttggttt cctcttccta ttgggcctgt acatctcatc cctggcttcc       960
     tgtatggggg gactctatgg cgcaccccgg atcctgcagt gcatcgccca ggacaaagtc      1020
     atccctgcac tcgcctttct ggcgaatggg aaagggccaa ataaaacacc ggtagcagcc      1080
     atctgcctga ccagcttggt gaccatggcc tttgtcctgg tgggtcaggt gaatgttctg      1140
     gcgcccgttg tcaccatcaa tttcatgctg acctacatca tggtggacta ctcttacttc      1200
     gccctctcca tggctcactg tggcctcgcc ccatctcctg agcccgtccc cagacaaggc      1260
     ccagatactc tgcactgctc tgagcacctg ctccaggaca gggctcccag ctacggctct      1320
     gatgtccctg ccagaagcct ctctgagggc accctgctgg agttcaccaa ggacatggat      1380
     cagttcctcc agccaataga ggaactggag agtcgtcagc ttgggtcaag agaaggaaac      1440
     aacccaaaga atcagaagcg caagggtaag aaaggcgcca agcaaaccct acaagatagc      1500
     ttcctcttgg accctgggtc tcctttgtcc tttcctacga ggacttctga gaggttgtct      1560
     gttgccttct gtggggagca agagtcctat cagaagcagc agacttctag gagtgaatca      1620
     catgaccatc ttgttcctga tctacgcaac cagcctagag tgaacagaga agatttcttt      1680
     ctgaaatgca gacttcagga acaagagatc cagagaagac caagtgtttt ctatgcttgc      1740
     atgtgtaacc cctgggtctc cctgttaggg gctcttgcat ccctgctcat catgtttgtg      1800
     atccagtggc tctataccct agctagtatg ggtgttgctg cccttgtgta tttctacatt      1860
     ggccaggcaa gtccaggcct ttacctcgga tcagcatcaa acttcagctt tttccaatgg      1920
     atgaagtcct tcttggtccc ctcctgcagg agcctgaggt ccgcccagga gcaaatcatc      1980
     ttggcgccat caccagccaa ggttgacatg gcaatgactc agcttaccca ggacaatgca      2040
     gacttcgcca cccgagatcg ttaccaccac tcctccttcc tgagccggga gcagttgatg      2100
     cctccctact aggacctcgc tggaccccac ctttctagaa gccgctgtgg agatggggga      2160
     cccaagcctc agaacctttg gaagttgctt ctaccaataa gaaaacccaa gactggtctt      2220
     cccaccacag ccttggacgc tggaaatcac attccggtct gaaatggcat gtctagccag      2280
     atactaggta tgactatggc ttccacgtgt gcccaacctg aagagtccac aggcaccagg      2340
     atgatcaggt gacaccaaga caaccaaatg tggagaatca aaacgagatt tcttattcta      2400
     aggggccaaa ataaacactt ctttttaaaa aaaaaaaaaa aaaaaaa                    2447
//


spacer
spacer