spacer

EBI Dbfetch

ID   AF316576; SV 1; linear; mRNA; STD; MUS; 1790 BP.
XX
AC   AF316576;
XX
DT   08-NOV-2000 (Rel. 65, Created)
DT   08-NOV-2000 (Rel. 65, Last updated, Version 1)
XX
DE   Mus musculus putative beta chemokine receptor (E01) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1790
RA   Luo Y., Berman M.A., Fischer F.R., Abromson-Leeman S.R., Kuziel W.A.,
RA   Gerard C., Dorf M.E.;
RT   "RANTES and eotaxin stimulate chemotaxis, chemokine/cytokine synthesis, and
RT   receptor modulation in murine astroctyes";
RL   Unpublished.
XX
RN   [2]
RP   1-1790
RA   Berman M.A., Dorf M.E.;
RT   ;
RL   Submitted (25-OCT-2000) to the INSDC.
RL   Pathology, Harvard Medical School, 200 Longwood Ave., Boston, MA 02115, USA
XX
DR   MD5; 2f2521f2d9c0ea820aedc15d4d5a8846.
DR   Ensembl-Gn; ENSMUSG00000043953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111888; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1790
FT                   /organism="Mus musculus"
FT                   /strain="B10.BR"
FT                   /mol_type="mRNA"
FT                   /tissue_type="TNF alpha treated bone marrow derived
FT                   dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             220..1302
FT                   /codon_start=1
FT                   /gene="E01"
FT                   /product="putative beta chemokine receptor"
FT                   /note="lipopolycaccharide inducible C-C chemokine receptor
FT                   L-CCR; transmembrane; G-protein coupled receptor"
FT                   /db_xref="GOA:O35457"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1920904"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35457"
FT                   /protein_id="AAG30950.1"
FT                   /translation="MDNYTVAPDDEYDVLILDDYLDNSGPDQVPAPEFLSPQQVLQFCC
FT                   AVFAVGLLDNVLAVFILVKYKGLKNLGNIYFLNLALSNLCFLLPLPFWAHTAAHGESPG
FT                   NGTCKVLVGLHSSGLYSEVFSNILLLVQGYRVFSQGRLASIFTTVSCGIVACILAWAMA
FT                   TALSLPESVFYEPRMERQKHKCAFGKPHFLPIEAPLWKYVLTSKMIILVLAFPLLVFII
FT                   CCRQLRRRQSFRERQYDLHKPALVITGVFLLMWAPYNTVLFLSAFQEHLSLQDEKSSYH
FT                   LDASVQVTQLVATTHCCVNPLLYLLLDRKAFMRYLRSLFPRCNDIPYQSSGGYQQAPPR
FT                   EGHGRPIELYSNLHQRQDII"
XX
SQ   Sequence 1790 BP; 429 A; 443 C; 416 G; 502 T; 0 other;
     tgttcccaca gccccctgga tggtagatca tggggctgca cccttcccca cccttgggaa        60
     ctcagtcaaa cggttatctt tatctcgcca gcttgtcctc gtgcttgacc agcgcagttt       120
     cacttttgca aacatctgtt tatatccctt gagagaaaaa atatcaagca acctgcctca       180
     aacgacgctg ttttgtccgg tgagcaagga cagcctccga tggataacta cacagtggcc       240
     ccggacgatg aatatgatgt cctaatctta gacgactacc tggacaacag tgggccggac       300
     caagttccgg cccccgagtt cctctccccc cagcaggtgc tgcagttctg ctgcgcggtg       360
     tttgcggtgg gtctcttgga caacgtgctg gcggtgttta tcttggtgaa atacaaagga       420
     ctcaagaatc tggggaacat ctacttccta aacctggcac tttcaaacct gtgtttcctg       480
     cttcccctgc cgttctgggc ccatactgca gcacacgggg aaagccctgg caatgggacc       540
     tgtaaagttc ttgtcggact ccactcctcg ggcttataca gcgaggtgtt ttccaacatc       600
     ctcctccttg tgcaaggata cagggtgttt tcccaagggc gactggcctc catcttcacg       660
     acagtgtctt gtggtattgt tgcgtgcatc ctggcatggg ccatggctac tgcgctctct       720
     ttgcccgagt ctgtgtttta tgagcctcgg atggaaagac agaaacacaa gtgtgccttt       780
     ggcaaacctc acttcttgcc aatcgaagcg ccgctctgga agtacgttct gacgtcaaaa       840
     atgatcatct tggtacttgc ttttcctctg ctggttttta taatctgctg caggcaactg       900
     aggagaaggc agagcttcag ggagagacag tacgacctcc acaagccggc tcttgtcata       960
     acgggcgtgt tccttttgat gtgggcgcct tacaacactg tgcttttcct gtctgctttc      1020
     caggaacact tgtccctgca ggatgagaag agcagctacc acctggacgc aagtgttcag      1080
     gtcacacagc tggtagcgac cacccactgc tgcgtcaacc cgctgctcta tttgcttctt      1140
     gaccggaagg cctttatgag ataccttcgc agcctgttcc cacggtgcaa tgatatcccc      1200
     tatcaaagta gtggaggcta tcagcaagcg cctccaaggg aaggtcatgg caggcccatt      1260
     gaactgtaca gcaatttgca tcaaaggcag gatataatat aatataaaca ctcaaccttg      1320
     tctcttcaca ttgttttatg ccatttttat atgtttgtat aaaaatagaa tataagagga      1380
     aagggggctg gttaatgaac atttactact aagcgttgaa tttgtctctg gcacacggtt      1440
     aagttattta taaaggtgaa ttccactctt cctctttagc gtttgtccgc agtgttatca      1500
     aagtagtgga ggctatcagc aagcgcctcc aagggaaggt catggcaggc ccattgaact      1560
     gtacagcaat ttgcatcaaa ggcaggatat aatataatat aaacactcaa ccttgtctct      1620
     tcacattgtt ttatgccatt tttatatgtt tgtataaaaa tagaatataa gaggaaaggg      1680
     ggctggttaa tgaacattta ctactaagcg ttgaatttgt ctctggcaca cggttaagtt      1740
     atttataaag gtgaattcca ctcttcctct ttagcgtttg tccgcagtgt                 1790
//


spacer
spacer