spacer

EBI Dbfetch

ID   AF310970; SV 1; linear; mRNA; STD; MUS; 2430 BP.
XX
AC   AF310970;
XX
DT   31-DEC-2003 (Rel. 78, Created)
DT   31-DEC-2003 (Rel. 78, Last updated, Version 1)
XX
DE   Mus musculus frizzled-10 like protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2430
RA   Yoshikawa Y., Shiraga H., Kawakami Y., Nohno T., Takada S.;
RT   "Cloning and expression of a mouse homolog of Frizzled-10";
RL   Unpublished.
XX
RN   [2]
RP   1-2430
RA   Shiraga H., Yoshikawa Y., Kawakami Y., Nohno T., Takada S.;
RT   ;
RL   Submitted (04-OCT-2000) to the INSDC.
RL   Center for Molecular and Developmental Biology, Graduate School of Science,
RL   Kyoto University, Kitashirakawa, Sakyo-ku, Kyoto 606-8502, Japan
XX
DR   MD5; b99c2df2aca8c683466ae004580831f2.
DR   Ensembl-Gn; ENSMUSG00000081683; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117102; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2430
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             179..2035
FT                   /codon_start=1
FT                   /product="frizzled-10 like protein"
FT                   /db_xref="GOA:Q71S95"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="MGI:MGI:2136761"
FT                   /db_xref="UniProtKB/TrEMBL:Q71S95"
FT                   /protein_id="AAQ14553.1"
FT                   /translation="MGMRGGPSRGAERGQQQQPVPGSGGPERRWDIAGATMQHPGPRLW
FT                   LVLQVMIGSCTAISSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQ
FT                   LHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFKF
FT                   RWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGSGMFPPLFRPQRPHSAQEHPLKDG
FT                   GPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAF
FT                   TVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYVIQEG
FT                   LESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIP
FT                   AVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALF
FT                   HIRRVMKTGGENTDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQHK
FT                   CKMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQHVCSRGL
FT                   KRKSRRKPASVVTSAGIYKKAQHPQKPHLGKYELPAQPSACV"
XX
SQ   Sequence 2430 BP; 489 A; 711 C; 707 G; 523 T; 0 other;
     ccgcggtccg cgatcgcccg cgcccggaag aagaggccaa agtttgcgcg ctgagcggcg        60
     ctcgctccgc cgtattgttt gcaaacttcg ctcccctccc ccgccgcccc ccgactccgc       120
     tgaggccgcg cgcccaccgc ggtggccccg ggcgccgcga gcgctccggc cagactggat       180
     gggcatgcgc gggggcccga gccggggcgc ggagcgcggg cagcagcaac agcccgtgcc       240
     cgggagcggc ggccctgagc ggcgctggga cattgcgggc gccaccatgc aacacccggg       300
     cccgcgcctg tggctggtgc tgcaggtgat gataggctcg tgcacggcca tcagctccat       360
     ggacttagag cgccctggag acggcaagtg ccagccggtg gagattccca tgtgcaagga       420
     catcggctac aacaccaccc gcatgcccaa cctgatgggt cacgagaacc agcgcgaggc       480
     ggccatccaa ctgcacgagt tcgcgccgct cgtggagtac ggctgccaca gccaccttcg       540
     cttcttcctg tgttcgctgt acgcgcccat gtgcaccgag caggtctcca cacccatccc       600
     tgcttgccgg gtcatgtgcg agcaggcccg gctcaagtgc tcgccgatca tggagcagtt       660
     caaattcagg tggccggact ccctggattg cagcaagctc cccaacaaga acgaccccaa       720
     ctacctgtgc atggaggcac ccaacaacgg ctcggatgag cccagccggg gctctggcat       780
     gtttcctccg ctcttcaggc cccagaggcc ccacagcgcg caggagcacc cactaaagga       840
     cgggggtccg gggcgcgcag gttgtgacaa cccaggcaag ttccaccatg tggagaagag       900
     cgaatcttgc gcaccgcttt gcactccggg ggtggatgtg tattggagcc gcgacgacaa       960
     gcgcttcgct gtggtctggc tggccatctg gtccgtgctg tgcttcttct ccagcgcctt      1020
     caccgtgctc accttcctca tcgacccatc gcgcttcagg taccccgaac gtcctatcat      1080
     cttcctctcc atgtgctact gcgtttattc ggtgggctat atcatccgcc tcttcgcggg      1140
     cgcggagagc atcgcttgtg accgggacag tgggcagctg tatgttatcc aggaaggact      1200
     ggagagcacg ggctgtacct tagtcttctt ggtactttac tacttcggca tggccagctc      1260
     tttatggtgg gtggtcctca ccctcacttg gttcctggct gctggaaaga agtggggcca      1320
     tgaggccatt gaagccaaca gcagctactt tcacctggca gcttgggcca tcccggctgt      1380
     gaagactatc ttgatcttgg tgatgcgcag ggtggcaggg gatgagctca ctggtgtgtg      1440
     ttatgtgggc agcatggatg tcaatgctct gaccggcttc gtgctggtcc cgctggcttg      1500
     ctacctagtc atcggcactt ccttcatcct gtccggcttt gtggctttat tccacatccg      1560
     gagggtgatg aaaacgggtg gggagaacac ggacaagctg gagaagctca tggtacgcat      1620
     aggggtcttc tccctcctct acactgtgcc ggccacctgt gtgattgcct gctattttta      1680
     tgaacgcctc aacatggact actggaagat gctggccacc cagcacaagt gtaagatgaa      1740
     caatcagacc aagacacctg actgcctgat gaccacctcc atccctgccg tggaggtctt      1800
     catggtcaaa gtgtccatgc tgctggtggt gggcatcacc agtggggtgt gggtctggac      1860
     ttccaagacc ctgcagtcct ggcaacacgt atgcagccgg gggctaaaga gaaaaagccg      1920
     gaggaaacca gccagtgtgg tcaccagtgc agggatctac aaaaaagccc agcaccccca      1980
     aaaacctcac cttgggaagt atgaactgcc cgcccagcct tcagcctgcg tgtgaaggca      2040
     gagctggctg caagaacagg acattcggag cccaaatggg cagcttttct tggttggctg      2100
     gttgttggta aatcaaagta aaaagaatat gtatatatat atacatgtat gtgtatgcat      2160
     gtgcatatat atgcatatat ttacacatac atgaagtcta ccttgaggtt cagaacagct      2220
     gaatgtaaag ggttctgttc agtttgttgc ctccctgaag ggtcgctcat taaggaggga      2280
     gcctcttgtg taactaattt gtggtaaagt agttgattca accgccctcc agaaaacttt      2340
     tgtttaggcc tcaagcacac agctgtgtat tcagaaggct ttgctgcctg tgcataaact      2400
     tgaggctgga gagctccttt gtaagctaaa                                       2430
//


spacer
spacer