spacer

EBI Dbfetch

ID   AF309565; SV 1; linear; mRNA; STD; MUS; 516 BP.
XX
AC   AF309565;
XX
DT   02-OCT-2001 (Rel. 69, Created)
DT   16-DEC-2008 (Rel. 98, Last updated, Version 3)
XX
DE   Mus musculus potassium channel Eag2 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-516
RA   Saganich M.J., Vega-Saenz de Miera E.C., Rudy B.;
RT   "Cloning of the Mouse Eag2 Potassium Channel";
RL   Unpublished.
XX
RN   [2]
RP   1-516
RA   Saganich M.J., Vega-Saenz de Miera E.C., Rudy B.;
RT   ;
RL   Submitted (28-SEP-2000) to the INSDC.
RL   Physiology and Neuroscience, NYU School of Medicine, 550 1st Avenue, New
RL   York, NY 10016, USA
XX
DR   MD5; 4b6e08c7def612edca5fac978403eecf.
DR   Ensembl-Gn; ENSMUSG00000034402; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042299; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..516
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>516
FT                   /codon_start=1
FT                   /product="potassium channel Eag2"
FT                   /db_xref="GOA:Q920E3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR003949"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="MGI:MGI:3584508"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q920E3"
FT                   /protein_id="AAL09442.1"
FT                   /translation="NAQIVDWPVVYSNDGFCKLSGYHRADVMQKSSTCSFMYGELTDKK
FT                   TIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKVVLFLCTFKDITLFK
FT                   QPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTETVHKHSRLAEVLQLGSDILPQ
FT                   YKQEAPKTP"
XX
SQ   Sequence 516 BP; 167 A; 110 C; 113 G; 126 T; 0 other;
     aatgcccaga ttgtggattg gcctgtagtt tatagtaatg acggtttttg taaactctct        60
     ggatatcatc gagctgacgt catgcagaaa agcagcacct gcagttttat gtatggagaa       120
     ctgaccgaca agaagaccat tgagaaagtc aggcagactt ttgacaacta cgagtcaaac       180
     tgttttgaag ttcttctgta caaaaaaaac cgtacccctg tttggtttta catgcaaatc       240
     gcaccaataa gaaatgaaca cgagaaggtg gtcttgttcc tgtgtacatt caaggacatt       300
     acactgttca aacagcctat agaggatgac tcaacgaaag gttggacgaa gtttgcccga       360
     ttgacacggg ctttgacaaa tagccgaagt gttttacagc agcttacacc aatgaataaa       420
     acagagacag tccacaagca ttcaagacta gctgaagtgc ttcagctggg atcagacatc       480
     cttcctcagt acaaacaaga agcgccaaag acgccc                                 516
//


spacer
spacer