
ID   AF307156; SV 1; linear; genomic DNA; STD; HUM; 96 BP.
AC   AF307156;
DT   14-MAR-2001 (Rel. 67, Created)
DT   14-MAR-2001 (Rel. 67, Last updated, Version 1)
DE   Homo sapiens MHC class II HLA-DQ-beta (HLA-DQB1) gene, HLA-DQB1*0603
DE   allele, partial cds.
KW   .
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
RN   [1]
RP   1-96
RA   Pascual M., Martin J., Zanelli E.;
RT   ;
RL   Submitted (22-SEP-2000) to the INSDC.
RL   Immunohematology and Blood Transfusion, Leiden University Medical Centre,
RL   Albinusdreef 2, Leiden 2300 RC, The Netherlands
DR   MD5; 8c8d736cecc8bfb27dbbadff433cca0d.
FH   Key             Location/Qualifiers
FT   source          1..96
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>96
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II HLA-DQ-beta"
FT   CDS             1..>96
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II HLA-DQ-beta"
FT                   /db_xref="GOA:Q9BCT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BCT8"
FT                   /protein_id="AAK17123.1"
FT                   /translation="MSWKKALRIPGDLRVATVTLMLAMLSSLLAEG"
SQ   Sequence 96 BP; 17 A; 25 C; 31 G; 23 T; 0 other;
     atgtcttgga agaaggcttt gcggatcccc ggagaccttc gggtagcaac tgtcaccttg        60
     atgctggcga tgctgagctc cctactggct gagggc                                  96