spacer

EBI Dbfetch

ID   AF306532; SV 1; linear; mRNA; STD; MUS; 1138 BP.
XX
AC   AF306532;
XX
DT   31-JUL-2001 (Rel. 68, Created)
DT   31-JUL-2001 (Rel. 68, Last updated, Version 1)
XX
DE   Mus musculus chemokine receptor CCR11 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1138
RX   DOI; 10.1016/S0165-5728(00)00371-4.
RX   PUBMED; 11063828.
RA   Dorf M.E., Berman M.A., Tanabe S., Heesen M., Luo Y.;
RT   "Astrocytes express functional chemokine receptors";
RL   J. Neuroimmunol. 111(1-2):109-121(2000).
XX
RN   [2]
RP   1-1138
RA   Luo Y., Berman M.A., Fischer F.R., Abromson-Leeman S.R., Kuziel W.A.,
RA   Gerard C., Dorf M.E.;
RT   "RANTES and eotaxin stimulate chemotaxis, chemokine/cytokine synthesis, and
RT   receptor modulation in murine astrocytes";
RL   Unpublished.
XX
RN   [3]
RP   1-1138
RA   Berman M.A., Dorf M.E., Rosenbaum D.;
RT   ;
RL   Submitted (18-SEP-2000) to the INSDC.
RL   Pathology, Harvard Medical School, 200 Longwood Ave., Boston, MA 02115, USA
XX
DR   MD5; de837c1fe8b4a6630a9afec1ceccce85.
DR   Ensembl-Gn; ENSMUSG00000079355; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076147; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1138
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             50..1102
FT                   /codon_start=1
FT                   /product="chemokine receptor CCR11"
FT                   /note="G protein-coupled receptor"
FT                   /db_xref="GOA:Q924I3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR005383"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2181676"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q924I3"
FT                   /protein_id="AAK81712.1"
FT                   /translation="MALELNQSAEYYYEENEMNYTHDYSQYEVICIKEEVRQFAKVFLP
FT                   AFFTVAFVTGLAGNSVVVAIYAYYKKQRTKTDVYILNLAVADLLLLITLPFWAVNAVHG
FT                   WILGKMMCKVTSALYTVNFVSGMQFLACISIDRYWAITKAPSQSGAGRPCWIICCCVWM
FT                   AAILLSIPQLVFYTVNQNARCTPIFPHHLGTSLKASIQMLEIGIGFVVPFLIMGVCYAS
FT                   TARALIKMPNIKKSRPLRVLLAVVVVFIVTQLPYNVVKFCQAIDAIYLLITSCDMSKRM
FT                   DVAIQVTESIALFHSCLNPILYVFMGASFKNYIMKVAKKYGSWRRQRQNVEEIPFDSEG
FT                   PTEPTSSFTI"
XX
SQ   Sequence 1138 BP; 278 A; 295 C; 269 G; 295 T; 1 other;
     aatgctgaat ggagtgccct gtgttcttct tgtcatccag ctcggtacca tggctctgga        60
     gctgaaccag tcagcggaat actattatga ggagaatgag atgaactaca ctcacgacta       120
     cagccagtac gaagtgatct gcataaaaga agaggtcagg cagttcgcaa aagtcttcct       180
     gcccgccttc ttcacagtgg cctttgtcac tgggctcgca gggaactccg tagttgtggc       240
     gatttacgcc tattacaaga agcagaggac caagaccgat gtgtacatcc tgaacctggc       300
     tgtagcagac ttgttacttc tgatcacgct gcctttctgg gcagttaatg cagttcacgg       360
     atggattcta ggcaaaatga tgtgcaaagt aacgtcagcc ctgtacacgg taaactttgt       420
     ctctgggatg cagttcctgg cttgtatcag cattgacaga tattgggcaa ttaccaaagc       480
     ccccagccaa tcaggagcgg ggagaccctg ttggatcatc tgttgctgtg tgtggatggc       540
     cgccatcttg ctgagcatac cccagctggt tttttacaca gtgaatcaga atgctaggtg       600
     cactcccatc tttccccacc acctaggaac atccctgaaa gcatccattc agatgctgga       660
     aatcggcatc ggctttgtgg tcccgtttct catcatgggc gtgtgctatg ccagtaccgc       720
     cagggcgctc atcaagatgc ccaacattaa aaagtctcgc cccctcaggg ttctgctcgc       780
     ggtggtggtg gttttcattg tcacccagct gccctataac gttgttaagt tctgccaagc       840
     catagatgcc atctacctgc tgatcaccag ctgcgatatg agcaaacgca tggatgtcgc       900
     catccaagtc acagagagca tcgcgctctt ccacagctgc ctcaacccca tcctgtatgt       960
     cttcatgggg gcctccttca aaaactatat catgaaagtg gccaagaaat atggatcctg      1020
     gagaagacag agacagaacg tggaagaaat tccttttgat tctgagggtc ctacagagcc      1080
     aaccagttct tttaccattt aaatataaaa ctgctctctg cctctgcttt ttgcttas        1138
//


spacer
spacer