Dbfetch

ID   AF305212; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF305212;
XX
DT   14-OCT-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*13 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Tamouza R., Keyhani M., Poirier J.C., schaeffer V., Fortier C., Labie D.,
RA   Charron D.;
RT   "New HLA-DRB1*13";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Tamouza R., Keyhani M., Poirier J.C., schaeffer V., Fortier C., Labie D.,
RA   Charron D.;
RT   ;
RL   Submitted (12-SEP-2000) to the INSDC.
RL   Immunology and Histocompatibility, Saint Louis Hospital, 1 Avenue Claude
RL   Vellefaux, Paris 75010, France
XX
DR   MD5; 034306772d426f2272de215e757e1d3d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:07:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAG22826.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 58 A; 64 C; 96 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//