spacer

EBI Dbfetch

ID   AF303744; SV 1; linear; mRNA; STD; MUS; 3763 BP.
XX
AC   AF303744;
XX
DT   02-JAN-2001 (Rel. 66, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Mus musculus oxidized LDL receptor (Lox-1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3763
RA   Park S.-H., Ahn H.-J., Cho J.-J.;
RT   "Mouse LOX-1 is expressed in mast cells after IgE cross-linking";
RL   Unpublished.
XX
RN   [2]
RP   1-3763
RA   Park S.-H., Ahn H.-J., Cho J.-J.;
RT   ;
RL   Submitted (07-SEP-2000) to the INSDC.
RL   Microbiology, Kyung Hee University, College of Medicine, Dongdaemun-Gu,
RL   Hoeki-Dong 1, Seoul, Korea
XX
DR   MD5; beadf563df4ba0fb207352231716de06.
DR   Ensembl-Gn; ENSMUSG00000030162; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032265; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3763
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="Cl.MC.C57"
FT                   /cell_type="mast cell"
FT                   /db_xref="taxon:10090"
FT   CDS             48..1139
FT                   /codon_start=1
FT                   /gene="Lox-1"
FT                   /product="oxidized LDL receptor"
FT                   /note="LOX-1"
FT                   /db_xref="GOA:Q9EQ09"
FT                   /db_xref="InterPro:IPR001304"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="MGI:MGI:1261434"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQ09"
FT                   /protein_id="AAG44998.1"
FT                   /translation="MTFDDKMKPANDEPDQKSCGKKPKGLHLLSSPWWFPAAMTLVILC
FT                   LVLSVTLIVQWTQLRQVSDLLKQYQANLTQQDRILEGQMLAQQKAENASQESKKELKGK
FT                   IDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSK
FT                   EQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQ
FT                   EALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFI
FT                   LQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGA
FT                   VFAENCILIAFSICQKKTNHLQI"
FT   repeat_region   2036..2330
FT                   /rpt_type=TANDEM
FT                   /rpt_unit_seq="agatag"
FT   polyA_signal    2432..2437
FT                   /gene="Lox-1"
FT   polyA_signal    3721..3726
FT                   /gene="Lox-1"
XX
SQ   Sequence 3763 BP; 1129 A; 765 C; 793 G; 1076 T; 0 other;
     gaggtcctcg actgtttcag tttttcactc ttagcatgaa tttggaaatg acttttgatg        60
     acaagatgaa gcctgcgaat gacgagcctg atcagaagtc atgtggcaag aagcctaaag       120
     gtctgcattt gctttcctcc ccatggtggt tccctgctgc tatgactctg gtcatcctct       180
     gcctggtgtt gtcagtgacc cttattgtac agtggacaca attacgccag gtatctgacc       240
     tcttaaaaca ataccaagcg aaccttactc agcaggatcg tatcctggaa gggcagatgt       300
     tagcccagca gaaggcagaa aacgcttcac aggaatcaaa gaaggaactg aaaggaaaga       360
     tagacaccct cacccagaag ctgaatgaga aatccaaaga gcaggaggag cttctacaga       420
     agaatcagaa cctccaagaa gccctgcaaa gagctgcaaa ctcttcagag gagtcccaga       480
     gagaactcaa gggaaagata gacaccatca cccggaagct ggacgagaaa tccaaagagc       540
     aggaggagct tctgcagatg attcagaacc tccaagaagc cctgcagaga gctgcaaact       600
     cttcagagga gtcccagaga gaactcaagg gaaagataga caccctcacc ttgaagctga       660
     acgagaaatc caaagagcag gaggagcttc tacagaagaa tcagaacctc caagaagccc       720
     tgcaaagagc tgcaaacttt tcaggtcctt gtccacaaga ctggctctgg cataaagaaa       780
     actgttacct cttccatggg ccctttagct gggaaaaaaa ccggcagacc tgccaatctt       840
     tgggtggcca gttactacaa attaatggtg cagatgattt gacattcatc ttacaagcaa       900
     tttcccatac cacctccccg ttctggattg gattgcatcg gaagaagcct ggccaaccat       960
     ggctatggga gaatggaact cctttgaatt ttcaattctt taagaccagg ggcgtttctt      1020
     tacagctata ttcatcaggc aactgtgcat accttcaaga cggagctgtg ttcgctgaaa      1080
     actgcattct aattgcattc agcatatgtc agaagaagac aaatcatttg caaatttagt      1140
     gaatctaaag attctggaga agaccatgag aagacttttg actgtcgctc tgaaatttaa      1200
     gctatttttt attacctgca tgtaaagcat gttggccttg acatctgtca gttacctgat      1260
     agctacagtt cacctcatca aagacaagga ccagaagcaa atactggtgg atccagatgt      1320
     ttgaaatctt tgtatcaaaa cgtgtgagtt caattgttta tccatataca ctggccttgc      1380
     ccctccaaag tctcccaacc aacctgcact ccttcttccc ctttgtgttt taaatgatgc      1440
     ttcctgcctg acctggccat gctttgtact cagtctcctc tacctcagta tgcctcctgt      1500
     tgctgcatga aagacaggat gtagaaatcc tcctcaagtg caggcagagg gctcaaaggc      1560
     aaagctcgtc cgagaaataa catgcaaaga aacagaactg gaaaaactac actgcaaaca      1620
     ggaactcatg atctctaaaa agccatggct tgatctttat gacaggagtc catctccaga      1680
     ctgcactttt acacacatat tttttatttt acttttattg tgaagtttat ggatagtttg      1740
     cctacttgaa ttctgtgtac cacatgagtg cctggtgcca ctgaagatca gaagaggaca      1800
     tcagattctc tggatctgga attccagatg gttgtaagct gctatgtaga tgtgaagaat      1860
     tgaattcggt gtcccctgga agaacagcca gtactctttg ccatgagcta tctctcaagc      1920
     tcctgtgatc aattcttgta tcagttatgt ctccattttt gctctaccaa agaacagtgt      1980
     tataacttta aaacagtaag tattttcatt attctagggg taatatagca gatatagata      2040
     gagatagaga tagagataga gatagagata gagatagaga tagagataga gatagagata      2100
     ggtataggta taggtatagg tataggtata ggtataggta taggtatagg tataggtaga      2160
     tagagataga ggtagaggta gaggtagagg tagaggtaga ggtagaggta gaggtagaga      2220
     tagagataga gatagagata gagatagaga tagagataga gatagagata gagatagaga      2280
     tagagataga gatagagata gagatagaga tagagataga gatagagata gatagtgtgt      2340
     gtgtgcgtgt gtgtgtttct atgctaggta cgatccttga ggagatgaga cagttttgtg      2400
     tgaaatgagt ttgtaataat ccaaatttaa aaataaattc gatgattacc tgtagtggtc      2460
     atattaccac agccaagatg atgaacatac ctgtcacttc tgccccttcc caaagcctcc      2520
     tccctaaaac aaacaccaat ctgctttcag ttcgcatttt atagagcttc tcattttgtt      2580
     tttaagacag aatctcatat agtcctggct ggcctggaac tcactacaca gagcaggctg      2640
     gcctccacct tctagagctc ctcctgccag actcccaaac cttaagactg aaggagtgcc      2700
     ctgccgtgtg tgactcaaac accttaatgt gaatggaaca gcataagatg tccaggtttt      2760
     ttcagtccag cttcttccac ttggtacaat ttttaatttt tgtgttcata catctccacc      2820
     acagtgtttg tatcagttca tcattctttt caaatgttga gccttcccct gtggatctat      2880
     agtgtcattt gttatctgtg tatttgttga tgccatttgg gttggttttg tctggggtca      2940
     cctacaaata aagctgctat ggatgtccat ggacaaggct aatatcttag gtaagcacct      3000
     acgagtaaga tgcttgggtc attcagtgtg ggaatatatg gttggctatt ttaaccattc      3060
     ctgtttgaaa acattaattt tttttatttt tgaaatcaat tttttaaaaa attaattagt      3120
     ctattttaca tctcaacccc agtttctctt cctcctctcc tctcaacctt ctcccacctt      3180
     ctctccctga ccccatccac ccctcctccc tttctctcca gaagagggga ggcctcccat      3240
     ggatgccaac cagcctcagc atctcaagtt acagtaagaa taggtttgtc ttctcctgtg      3300
     aaaatcttaa tttttagatt tatctattat atatgcagta ctttgcttgc acatatgtat      3360
     tggtaccatg tacatgcatg gtaccagaga aagtcagaag aggccattgt attttctggg      3420
     actggaatta cagacgtttt tgaacaatcc tatagactct gggaactgaa cccaggtcgt      3480
     ctggaaaggc aagcagtgct cttaacccct gagccatttc ttctggcctt ttagcaattt      3540
     ttattaatat ataactgtgt atacttgcac ttttagctcg aagttcttaa gtgtcaaata      3600
     gtcttggatt tattttcatg ttatcactgt ctgtacaatt tctgtgatga aataactgag      3660
     catatatttt gagaatttgg ttttcttaaa ttttaaatct gaaggattta catatttgag      3720
     aataaaaacc agccagatac ataaaaaaaa aaaaaaaaaa aaa                        3763
//


spacer
spacer