spacer

EBI Dbfetch

ID   AF302278; SV 1; linear; genomic DNA; STD; MUS; 871 BP.
XX
AC   AF302278;
XX
DT   20-NOV-2000 (Rel. 65, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Mus musculus SIR2L3 (Sir2L3) gene, exon 7 and complete cds, alternatively
DE   spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-871
RX   DOI; 10.1006/geno.2000.6360.
RX   PUBMED; 11056054.
RA   Yang Y.H., Chen Y.H., Zhang C.Y., Nimmakayalu M.A., Ward D.C., Weissman S.;
RT   "Cloning and characterization of two mouse genes with homology to the yeast
RT   Sir2 gene";
RL   Genomics 69(3):355-369(2000).
XX
RN   [2]
RP   1-871
RA   Yang Y.H., Chen Y.H., Zhang C.Y., Nimmakayalu M.A., Ward D.C., Weissman S.;
RT   ;
RL   Submitted (05-SEP-2000) to the INSDC.
RL   Genetics, Yale Medical School, 333 Cedar Street, New Haven, CT 06536, USA
XX
DR   MD5; 28ed87fd013e67b9c01bedcffd0a7841.
DR   Ensembl-Gn; ENSMUSG00000025486; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026559; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106048; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..871
FT                   /organism="Mus musculus"
FT                   /strain="129/Ola"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(AF302273.1:1287..1438,AF302274.1:1294..1481,
FT                   AF302274.1:1556..1788,AF302275.1:543..643,
FT                   AF302276.1:188..349,AF302277.1:415..624,397..810)
FT                   /gene="Sir2L3"
FT                   /product="SIR2L3"
FT                   /note="alternatively spliced"
FT   mRNA            join(AF302273.1:1727..1833,AF302274.1:1294..1481,
FT                   AF302274.1:1556..1788,AF302275.1:543..643,
FT                   AF302276.1:188..349,AF302277.1:415..624,397..810)
FT                   /gene="Sir2L3"
FT                   /product="SIR2L3"
FT                   /note="alternatively spliced"
FT   CDS             join(AF302274.1:1435..1481,AF302274.1:1556..1788,
FT                   AF302275.1:543..643,AF302276.1:188..349,
FT                   AF302277.1:415..624,397..417)
FT                   /codon_start=1
FT                   /gene="Sir2L3"
FT                   /product="SIR2L3"
FT                   /db_xref="GOA:Q8R104"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="MGI:MGI:1927665"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R104"
FT                   /protein_id="AAG33227.1"
FT                   /translation="MVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFH
FT                   NPKPFFMLAKELYPGHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVE
FT                   AHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCAVCTGVVKPDIVFFGEQLPARFLLH
FT                   MADFALADLLLILGTSLEVEPFASLSEAVQKSVPRLLINRDLVGPFVLSPRRKDVVQLG
FT                   DVVHGVERLVDLLGWTQELLDLMQRERGKLDGQDR"
FT   exon            397..810
FT                   /gene="Sir2L3"
FT                   /number=7
XX
SQ   Sequence 871 BP; 199 A; 202 C; 212 G; 258 T; 0 other;
     gagaagcctg gcatattaag gagccgtggc atttactgct cccacagatg agatgtaacc        60
     accagtattg atctttttgt tccaaggctt ggttcttaag gctgaatgta cgcaggtgcc       120
     atttattaga aaacagtcta tgttttgtgc taggccttct gggttccctt ttcttattca       180
     tttcaaagac aaaagtttgt tccataaaat attttttacc tcaatgactg atccatgtct       240
     aggatctgct agcctctgtg tgtgatgtta actgacctct gcctgttcta gctggatggt       300
     gctggctctg tgtgtgatgt taactgacct ctgcctgttc tagctggatg gtgctggctc       360
     tgtgtgtgat gttaactgac ctcttgtctg ttctagctgg atggacagga cagataagac       420
     tatggcttct tcacctgggg aagtcacaca gcagatcatc ctatgtccag caagacttca       480
     tgcctgaaga cagctccaac acgtttacaa acatgaacca gaccacaaca tgtggcctgg       540
     acagtggtcc tccgaggctg cctttggaaa ggctgaccag ggatgtctac ccttggggcc       600
     cctccatgtg tgcgccctgt ccacctcatc actgctgaag gtgtagtgca ggtgctgctt       660
     tctgcagcgg cccttaagtt atcacgaggg cagcacagca cgcccgtcgc caggcaggcg       720
     atgcactagg gcaatctagc atgttgatcg gtaaagtggc atctttaact acaacatcat       780
     ttcttgcatg aaataaactt agtataaaaa cttggcatcc tgtctctttg ggatagtgag       840
     tgttgacaaa cttcaggtta tgtgggtgtt c                                      871
//


spacer
spacer