Dbfetch

ID   AH010003; SV 2; linear; genomic DNA; STD; MUS; 10657 BP.
XX
AC   AH010003; AF302273-AF302278;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Mus musculus strain 129/Ola SIR2L3 (Sir2L3) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-10657
RX   DOI; 10.1006/geno.2000.6360.
RX   PUBMED; 11056054.
RA   Yang Y.H., Chen Y.H., Zhang C.Y., Nimmakayalu M.A., Ward D.C., Weissman S.;
RT   "Cloning and characterization of two mouse genes with homology to the yeast
RT   Sir2 gene";
RL   Genomics 69(3):355-369(2000).
XX
RN   [2]
RP   1-10657
RA   Yang Y.H., Chen Y.H., Zhang C.Y., Nimmakayalu M.A., Ward D.C., Weissman S.;
RT   ;
RL   Submitted (05-SEP-2000) to the INSDC.
RL   Genetics, Yale Medical School, 333 Cedar Street, New Haven, CT 06536, USA
XX
DR   MD5; 77ac077276c5a909809e9bbaf5bdd4cc.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:11228930, gi:11228931, gi:11228932, gi:11228933, gi:11228934,
CC   gi:11228935, gi:11228929.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..10657
FT                   /organism="Mus musculus"
FT                   /strain="129/Ola"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            1287..10596
FT                   /gene="Sir2L3"
FT   mRNA            join(1287..1438,5271..5458,5533..5765,6941..7041,
FT                   7895..8056,9123..9332,10183..10596)
FT                   /gene="Sir2L3"
FT                   /product="SIR2L3"
FT                   /note="alternatively spliced"
FT   exon            1287..1438
FT                   /gene="Sir2L3"
FT                   /number=1A
FT   mRNA            join(1727..1833,5271..5458,5533..5765,6941..7041,
FT                   7895..8056,9123..9332,10183..10596)
FT                   /gene="Sir2L3"
FT                   /product="SIR2L3"
FT                   /note="alternatively spliced"
FT   exon            1727..1833
FT                   /gene="Sir2L3"
FT                   /number=1B
FT   gap             3878..3977
FT                   /estimated_length=unknown
FT   exon            5271..5458
FT                   /gene="Sir2L3"
FT                   /number=2
FT   CDS             join(5412..5458,5533..5765,6941..7041,7895..8056,
FT                   9123..9332,10183..10203)
FT                   /codon_start=1
FT                   /gene="Sir2L3"
FT                   /product="SIR2L3"
FT                   /protein_id="AAG33227.1"
FT                   /translation="MVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFH
FT                   NPKPFFMLAKELYPGHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVE
FT                   AHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCAVCTGVVKPDIVFFGEQLPARFLLH
FT                   MADFALADLLLILGTSLEVEPFASLSEAVQKSVPRLLINRDLVGPFVLSPRRKDVVQLG
FT                   DVVHGVERLVDLLGWTQELLDLMQRERGKLDGQDR"
FT   exon            5533..5765
FT                   /gene="Sir2L3"
FT                   /number=3
FT   gap             6299..6398
FT                   /estimated_length=unknown
FT   exon            6941..7041
FT                   /gene="Sir2L3"
FT                   /number=4
FT   gap             7608..7707
FT                   /estimated_length=unknown
FT   exon            7895..8056
FT                   /gene="Sir2L3"
FT                   /number=5
FT   gap             8609..8708
FT                   /estimated_length=unknown
FT   exon            9123..9332
FT                   /gene="Sir2L3"
FT                   /number=6
FT   gap             9687..9786
FT                   /estimated_length=unknown
FT   exon            10183..10596
FT                   /gene="Sir2L3"
FT                   /number=7
XX
SQ   Sequence 10657 BP; 2487 A; 2390 C; 2530 G; 2750 T; 500 other;
     ctggtaagtc ataaccttaa tgagaccatc tccttgggca aagcatgggt cctgcacaaa        60
     aatcaagcac ctcaagtgtc agctgatgcc acaacctaca aaacaaaaag ccctcagtcc       120
     cacatcctaa tgtgaagaaa aggatgcctt cagccttgac ggtcccatca aacaccaagt       180
     atttcccagg tcccactgca cagccaggag ttaaagcaag cgccagccaa ttcaagccta       240
     tttctggact gactttgctt gcacccccta gtcacttatc ctttcaagac tcagttttct       300
     taggtaacac tggagaacac tttttgagac agcgtcaact cccactctga gtgtcaactg       360
     gaattccaat gccacaacct acaaaacaaa aagccctcag ccccacatcc taatgtgaag       420
     aaacggatgc cttcagcctt gaaggcattg gttgtgactt tagaattcta cagctatatt       480
     ttgaactcca ttctctctta cttattagct gaatacctca cagaatagaa aactgatatt       540
     caatcttatc tgtcaatagg aaggatgaaa taagccaata ctttaaaaaa gccaatatat       600
     gaacctttag gacaccgaaa gcatactttc atccccaaga ctaaaggata atttttaata       660
     atagagataa aagtgttttg aaaaacacaa aatgttacac catatatagg caggtacata       720
     ttaaccactg aaaaattttt tcttgaaatc actaagagtt ttaactgttg gacattgtca       780
     tgtggaaagg ttctgaggaa gaggtgtttt ttcataggca aattcttata tcaaagtcag       840
     caattcgtaa ttgttcttat caaagctggt aaggctggaa cgcagggagt ctagatacag       900
     aaccctgtta acagctctgc tcctaaggct atctcgaccc ctttcctcca catccctgac       960
     cctccggact gatcagagcc cctggccctc ccacagtcct ctccctcccg ccccagcctc      1020
     ggagctcact tcttcgtgta cagctcttcc aaacggtgcc aaacggcagc ctggcccggc      1080
     ccggagctct gactctgctg taagaaggcc ggcacatcct tcatgattgc agagagctgg      1140
     gaacaacaca agcactaagc agtcagaacc ggcagggatg gcgcacggaa gtgctcgctc      1200
     acttccggca ccgcgggcgc gcggggcatg ctgggagcgt cccactagcc tcacgggttg      1260
     cggtcgtcaa ggtaaccgcg ttcttgactt ccgctaaact tctcccgggt ttctggccct      1320
     gcccttgagg cattaaagag tagaggtgcc tggggacagc tagccactga ctggtcacgt      1380
     agcctcaagc ctgcagactt gggtcctctg aaaccggatg gcgtttggcg aggactaggt      1440
     gtgatgcaaa tcgctcagag agcattagtt atcacccgcc tactcaagga ggtcgagagc      1500
     ggcgtaaaac gatgaaatct cccggtttgg cttcccaacc aataagtcag agtcccacag      1560
     agggagaagc tgccagcacc aggcataaac acagccttcc acacttcggg ttatcgtgcg      1620
     ggggctgggc tgggctcggc cgagggaagg cgccggaggg cggcacttgg ccagaggggg      1680
     ggcgggagta agagtgccga gagggcgggg cttggctcac gggggcgggg attcggatgg      1740
     cgcttgaccc tctaggcgcc gtcgtcctgc agagcatcat ggcgctaagc ggtcgactgg      1800
     cattggccgc gctcagactg tggggtccgg gaggtgagcc acggcagggg agacacggga      1860
     tctcgcagat aggctatcag cggcgtttta ggggcgggta gctggaagca attgtgggag      1920
     taaggacccg gcaggcgcgc ccttctacaa ggttttgctg accggccatc actaccttct      1980
     ccttaaaggt gtttttctat gtaactattg cagcacagtc tttgaaatat tttatagaag      2040
     ttcgttgtat ggatgtctta taatttatat caccatttcc ttattgaata ctttctaatc      2100
     ttgaattatt acaaataacg tgataaataa acgtgtttgc accccatttg gaccacaaat      2160
     tctcagtaga cagccttgta aggttacgtg gtttgtatta ttttgagact ggtctcttgt      2220
     tcaaactggc cttcagctgg ctgtgtgaag gaggatgacc ttgaactccg gatccacctt      2280
     gcttccaccc ccctccaagc gtcggagact acagtcacat gccaccacat ccagctgtta      2340
     cttgtgtttt aattgtcccc cataaaggtt gtgaaactaa aaatttttac caacagtcat      2400
     actgtctgca aaatagtaac atgtctcata gagtcctgag agtgatcaat aatagggata      2460
     ttttcagttt gaaataagtg agtatattaa gttagagaga aatcatcaca ctgcatattc      2520
     aaaaaaaaaa aaaaaagtca gcagacgtct attggctatc tttaaggtag ctcggtggaa      2580
     ctcccagtaa agagtccttg ccagaacaga gtgacccttt cagtgaggtt tttagtaaag      2640
     caacagatgg aagtaatatc aaattggaca cttgctacat ctaacagaaa ctggcagaga      2700
     aagttgagat agtcatttgg agctcccagg tgggctgtcc ctctgtctga gctgcgggat      2760
     ttccttccta ctggagggca cattcttttt cttgcagata ctttcctata ctgggataaa      2820
     ctatagtgac ttccactgga aaccgtttcc cttctgttct caagggcaca agtgttttca      2880
     ctcttgggct gttttgctgt tctctctctg tccttttaca tagttagggg agccagccct      2940
     ccagactttg gactttgaga caaacatggg tctggcatga gggaaggggt tgtcggcctt      3000
     gtttccaaag ccatcttctc agtgagctca aatgacgcaa gacaatttat caatataatg      3060
     tacaaatttg gacttttttt ttttgtctgt gctgagtaac aaactcaggc tttgcaattg      3120
     tctgataggc taacatggca ccactgaact acacacccag cctggagtcc ttacagtttt      3180
     agggcccaca gtcgttagca aagaaatgta atggaagaat atttgggtag acaatggtat      3240
     agtcacttga tgtgggtgac aacattttat tcttttcaat aaagagttgt tcatttaggc      3300
     tacggttaca gagcattttc tctaccatac tcgtgagtgc tgaggataaa gcagggatca      3360
     gaaaagacac tctaacttgt ggaagcattt ctaatatgag atcatctgta agacagtgtg      3420
     gctgtcataa accctaacac aggagccctg ggatgtttgt gaggaggatg cctttacaga      3480
     acattccttc ttctcttgat tttaaaattg ggactctttt gtgacttcat tctctgtact      3540
     ttacaatggc ttgggcagaa ctgaatacta acccctgagt ttcttcatct caggggcttt      3600
     ccatacccat gtagatgtac tttaagttat atcttaagtt tgttgttaga tatttggtaa      3660
     aattttgtcc acatgtatgt ctgtcagttg caaactgttt gtttgtttgt ttgttttggt      3720
     acaagtgact aaaaatgtct tttatgttcc ctgagtggtg cctagcggtt ggcagacact      3780
     cagcaatggt cacaactttt cttttgtccc ttttgtattc tcatatggtt tgtgtttaag      3840
     aggagttcaa aaaatattag ggcaaaacct ctgagtgnnn nnnnnnnnnn nnnnnnnnnn      3900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3960
     nnnnnnnnnn nnnnnnnggt accaaaaaac gggcgatttt gtttcttgtg tgttttcccc      4020
     agttggaata aggttccttc caaggaacaa attttcttgt cttaggcttt cagtgaagtg      4080
     ttgtgttttg gggagttctc tttgattcct ctgtcctgat ggactagaga gagcaagtgc      4140
     ctcttatctc caccatcttt atgattaggc ccccacagga gttctaaact aaaagggcca      4200
     ggttgcaatg aggaagagcc agagacaaaa aggcaggcgt gccgagagaa aatcgagact      4260
     gctggaaaac agattctggt gaacgctcta ctacagatgt tctaacagtt gctctgcaac      4320
     agcaagaggc cacctagtac gtgctcagat aagccagtgg accatcagct aaacgaaagc      4380
     aggtccagac tgggtcccag ggagcactct catactctat ccaaggaggt gacacagaca      4440
     gttggacaca aaggcctgtt ctggcccttg gcactgctcc tgatgacacc tcggatggga      4500
     caggatcatc catgggcatc tcacactggg tgcctagacc atgggcacaa ggcacagctc      4560
     ttgcttgctt caaagtgaat aatgcatagc ttactgtgaa cccagtatga atgatcgtgc      4620
     cctggaaaca cagactcggg ttacacgaaa taatctcact tatggaaggg gttatacaaa      4680
     cttctagtct cagaacaaaa gatagtcaga aattcactca cttactgaat atcagtggga      4740
     acgttaggca gcagtaaaat catcctattg gcttccgata tgctctaacg ggagtctttg      4800
     ctcctgggct agtggaagct tgtggtcttt gaagtcaaga acattccaaa gtccttattt      4860
     aatagtcaaa aaggatgtta ggtatcctta tccaggggga taaagatagc tcaagataag      4920
     tttagttttg aatctgcaac atcccaactt ctaaagtccc atctggccag tcagctgtgt      4980
     tttctcagag cccttcagct cacaccattg atgatgagaa gcatcaggga acctgtctgc      5040
     aaacctgtct gtaaatcaga attttcttgc ccccaagtaa atctcgattc ctgatgcaag      5100
     atggttctgt gctttagttg gtagtcatgc gtggtgggaa agtggttgtt tggctggcac      5160
     tggagaggcc atgtccacct ttgacggggg gaagagtcca gctgccctca ctcttgctag      5220
     cctaagactg actgttgcct gctgcctctc tcctgcgctc ttgctgtcag tgttacaggt      5280
     gggagaaggc ccatatccct ctgtgtggga gcctcaggcg gctttggagg tggaggaagc      5340
     agtgagaaga agttttctct gcaggatgta gctgagctgc ttcggaccag agcctgcagt      5400
     gggtggtggt catggtgggg gccggcatca gcacacccag tggcatcccg gacttcaggt      5460
     atgctgcggt tcccttgggt gtcatttccc cactgtcttc tgcagggctc agccttttcc      5520
     ttctctctgc agatccccag ggagcggcct ctacagcaac cttcagcagt atgacatccc      5580
     gtaccctgaa gccatctttg aacttggctt tttctttcac aaccccaagc cctttttcat      5640
     gttggccaag gagctgtacc ctgggcacta caggcccaat gtcactcact acttcctgag      5700
     gctcctccac gacaaggagc tgcttctgcg gctctataca cagaacatcg acgggcttga      5760
     gagaggtgag cctttggccc cttgcatgtc tgtgcttgtt tctcaggact gcctacggcc      5820
     tagtgtttat gtcggccctg gactgttgct aggcagctgg ttatgccttt accacttctg      5880
     catttgaggc cacatggaaa cctctctgta ggcctgtctc ctgcacacct tctgagtcct      5940
     gagttttaga tggaactaaa attcatacaa ttttaaatct agtgtggatc tcccctctct      6000
     ctgcctctct ctctcttctt ctctttccat ctctttctcc ttcccttttt cttcccttcc      6060
     ctcttcctcc cactttctct ccatctctgg ctcccaccta aggaaccctt aggtcctttc      6120
     ttccatttcc atgtgtgaca catggccagg ccttgttctc tgttccctcc acctcctctt      6180
     tcaccctcag attattttca ggcagatacc tcacaccatg ggtgctacta tagaaacaat      6240
     gtctagatgt ttatggatat gtctggaaga taaagcttgt tgcaagcaat agctctgann      6300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnntg cttcctcaag gtgcaatatg      6420
     caggcccatg gcagatccag ccactctgcc attctgtgga gtgctgtggt ctgaagtaag      6480
     acatcacatt gcgggatagg agtcctgtga gaaggaatct acaacccaga accagagaca      6540
     gtagtgacca ccccaagttt ccccctaagc agaaggaaag gttttagggg aagataggaa      6600
     tttcctggct ttgggtttaa gcagtacagt taccaaagag cagtaatgaa cttcatgaga      6660
     gcccggttgt tgttccgagg aggttctgct agagcccaca ctcacctcaa acgtactccg      6720
     tagctcagac tgtcttgggg ctctcagctc tttagcctca gcctccccag tgctaggatt      6780
     gtgtgcttgt gccaccacgt gcagctgaga ggtccctttc tgtttgctta cctgccatag      6840
     agtttttttg aaatcagttt tgtcaagccc agaaggtgag cttgtgtgct tacatagcca      6900
     tcccagaggc tgcaacactg agatttgctt tgaatttcag catctgggat ccctgcctca      6960
     aagctggttg aagcccacgg gacctttgta acagctacat gcacggtctg tcgaaggtcc      7020
     ttcccagggg aagacatatg ggtgagtcac ctcaggaaat agtctctgcc ttctgcaatt      7080
     cttgggggta gaggatctta taatagtttg ttttgtgctt gtttatttgt ttgtttcaaa      7140
     acaggacgct cacagaggtc tgaaactcac caaaatagct aggctggttg gtcaggcaac      7200
     cttaaagatc caccctaagg atctctgcct ccccagtgct gggattacat tatacatcac      7260
     catacttggc tttgtttgtt tagacaaggt ctcactattt agaccaggtt ggcctataac      7320
     acaaagagat ccatcagctt ctgtgggatt caggatgtgc tccaccatgc ctggctccca      7380
     aacttttgac ttagaaaaat aatacatact tgtaaaggaa cataaggctg ggctgagaat      7440
     gtgacgcagc tcaatggtgg agtgcttgcc tagcataaac ggccctgggc tctatggcca      7500
     gtgctccctc caccccaaaa atgcaggtca gaaatatata agggaaaatg aattccccat      7560
     ggcagcatgg ttgagcacac ctttaatccc agaacttggg agcaagannn nnnnnnnnnn      7620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7680
     nnnnnnnnnn nnnnnnnnnn nnnnnnntga agcccccaac cccccccccc ccgctcccca      7740
     catctaagaa atagttgaca gaaattgtta aagccacatg gggaccatta cagagtgaag      7800
     atttttggac ctgttcgaca tctccttgaa gagcttttgt gttttcctct tttaaaagtc      7860
     atcttcctcc cccaaccctc ttctgattcc ccaggctgat gtgatggcgg acagggtgcc      7920
     ccgctgcgct gtctgtactg gcgttgtgaa acccgacatt gtgttctttg gggagcagct      7980
     gcctgcaagg ttcctactcc atatggctga cttcgctttg gcagatctgc tactcattct      8040
     tgggacctcc ctggaggttt gttgaaaggc atgtggggat gggtaggagg gcggtgtgga      8100
     gggctagggc ctggttgacg gtgtcacctt ttcaggtgag gagagtcact ggtggtgaca      8160
     cttagggttt gaggacaatg gctgtgtagg agggcgtaag ggtgtagtga aaggttagcc      8220
     atggggcagg gctgaaagga ctgatctcgg cacagagctg tactatggga tgaagagcac      8280
     atggcggccc tgaagtgacc tttggtggga ggaggttggc tgcagcatca gcagttagct      8340
     ggtacggggc agtcagagga ccagtagggt tggggtctgc atgcaggtat gtctgtggct      8400
     ctgtatggag atgaccactg atctgcatct gagtcagaat gccagcgagt ttccaaaagg      8460
     tgtaaagagg caagaccacg ggctggagcc catctgtgtg tagacatagg ggcaaaaggt      8520
     ccaaaaagct ctgttcagga ggccagctgt gcaaggctga ggtctgtgca ctcagcctgc      8580
     cactgtcact gcgtgatgtt aacaggccnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      8640
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      8700
     nnnnnnnncc accgttattc ttggtgcaga aataggacac tgatggggac ccaggaagtg      8760
     ggacagtagc agggtgataa agggtacttg ctcctctttg tcaggcaagt ataggggagg      8820
     ctcagagcag ggccccggct gtagagtgga cagagcaggt agaaggacaa tgcttgcggg      8880
     cagaacatgc agacagggga ggaggatgga gtgtggggag aagtcagagc ttgtattggc      8940
     ccacccagca gaagagaggg gctatggatg ggaaagagat cacccgacca gggggtaaaa      9000
     gcctttgtaa actaagtggc aggctctttg tgtcagtctc ctgccccaag gtgtcagtga      9060
     ctagtgttca atgtcctgat gtgcatggtc acactgcctc tcacatttgg gttatctttc      9120
     aggtggagcc ttttgccagc ttgtctgaag cagtacagaa atcagtgccc cgactgctca      9180
     tcaatcgaga cttggtgggg ccgttcgttc tgagtcctcg aaggaaagat gtggtccagc      9240
     taggggatgt agttcatggt gtggaaaggc tggtggacct cctggggtgg acacaagaac      9300
     tgctggatct tatgcagcgg gaacgtggca aggtacagtg gctctggccg gtccgacaga      9360
     gtgcatcctc tctggtcact gccctcagtg cgtggctggc gtttaggagc gtggtgcccc      9420
     tacagaccat tgcttttgct tcctactcta cagctctctg ctgggacatg gttctgggac      9480
     ctagggaggg gaagggctga gaagctgaca ttctctgctc cctgcatggg acagagctaa      9540
     cctgaaatgg tttgttaatc agtgccatta tctagtatag ccggtgggaa taggaagcct      9600
     gggaacactg ctctaggttt tatagtacct gtgaatcaca ggaaataatc tcctgtgaga      9660
     accaggttat atgtgattat tataaannnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9780
     nnnnnngaga agcctggcat attaaggagc cgtggcattt actgctccca cagatgagat      9840
     gtaaccacca gtattgatct ttttgttcca aggcttggtt cttaaggctg aatgtacgca      9900
     ggtgccattt attagaaaac agtctatgtt ttgtgctagg ccttctgggt tcccttttct      9960
     tattcatttc aaagacaaaa gtttgttcca taaaatattt tttacctcaa tgactgatcc     10020
     atgtctagga tctgctagcc tctgtgtgtg atgttaactg acctctgcct gttctagctg     10080
     gatggtgctg gctctgtgtg tgatgttaac tgacctctgc ctgttctagc tggatggtgc     10140
     tggctctgtg tgtgatgtta actgacctct tgtctgttct agctggatgg acaggacaga     10200
     taagactatg gcttcttcac ctggggaagt cacacagcag atcatcctat gtccagcaag     10260
     acttcatgcc tgaagacagc tccaacacgt ttacaaacat gaaccagacc acaacatgtg     10320
     gcctggacag tggtcctccg aggctgcctt tggaaaggct gaccagggat gtctaccctt     10380
     ggggcccctc catgtgtgcg ccctgtccac ctcatcactg ctgaaggtgt agtgcaggtg     10440
     ctgctttctg cagcggccct taagttatca cgagggcagc acagcacgcc cgtcgccagg     10500
     caggcgatgc actagggcaa tctagcatgt tgatcggtaa agtggcatct ttaactacaa     10560
     catcatttct tgcatgaaat aaacttagta taaaaacttg gcatcctgtc tctttgggat     10620
     agtgagtgtt gacaaacttc aggttatgtg ggtgttc                              10657
//