Dbfetch

ID   AF301619; SV 1; linear; mRNA; STD; MUS; 1358 BP.
XX
AC   AF301619;
XX
DT   05-DEC-2000 (Rel. 66, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus interleukin 23 p19 subunit mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1358
RX   DOI; 10.1016/S1074-7613(00)00070-4.
RX   PUBMED; 11114383.
RA   Oppmann B., Lesley R., Blom B., Timans J.C., Xu Y., Hunte B., Vega F.,
RA   Yu N., Wang J., Singh K., Zonin F., Vaisberg E., Churakova T., Liu M.-R.,
RA   Gorman D., Wagner J., Zurawski S., Liu Y.-J., Abrams J.S., Moore K.W.,
RA   Rennick D., de Waal-Malefyt R., Hannum C., Bazan J.F., Kastelein R.A.;
RT   "Novel p19 protein engages IL-12p40 to form a cytokine, IL-23, with
RT   biological activities similar as well as distinct from IL-12";
RL   Immunity 13(5):715-725(2000).
XX
RN   [2]
RP   1-1358
RA   Kastelein R.A., Gorman D., Timans J.C., Oppmann B., Bazan J.F.;
RT   ;
RL   Submitted (30-AUG-2000) to the INSDC.
RL   Molecular Biology, DNAX Research Institute, 901 California Avenue, Palo
RL   Alto, CA 94304, USA
XX
DR   MD5; bb137461bb32394b2e4f75698d4b3e8b.
DR   Ensembl-Gn; ENSMUSG00000025383; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017857; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017832; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017795; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017796; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017619; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018251; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017180; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017589; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017695; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017690; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017769; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017718; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018291; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016965; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017239; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026449; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027486; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027452; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027423; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027430; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027238; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027937; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026837; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027167; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027290; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027282; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027406; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027265; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027960; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026540; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026756; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1358
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             113..703
FT                   /codon_start=1
FT                   /product="interleukin 23 p19 subunit"
FT                   /note="four helical bundle cytokine; combines with the p40
FT                   subunit of IL-12 to form a novel, biologically active,
FT                   composite cytokine, IL-23"
FT                   /db_xref="GOA:Q9EQ14"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR010831"
FT                   /db_xref="MGI:MGI:1932410"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQ14"
FT                   /protein_id="AAG37231.1"
FT                   /translation="MLDCRAVIMLWLLPWVTQGLAVPRSSSPDWAQCQQLSRNLCMLAW
FT                   NAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHL
FT                   LDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLR
FT                   SKILRSLQAFLAIAARVFAHGAATLTEPLVPTA"
XX
SQ   Sequence 1358 BP; 383 A; 326 C; 338 G; 311 T; 0 other;
     cgcttagaag tcggactaca gagttagact cagaaccaaa ggaggtggat agggggtcca        60
     caggcctggt gcagatcaca gagccagcca gatctgagaa gcagggaaca agatgctgga       120
     ttgcagagca gtaataatgc tatggctgtt gccctgggtc actcagggcc tggctgtgcc       180
     taggagtagc agtcctgact gggctcagtg ccagcagctc tctcggaatc tctgcatgct       240
     agcctggaac gcacatgcac cagcgggaca tatgaatcta ctaagagaag aagaggatga       300
     agagactaaa aataatgtgc cccgtatcca gtgtgaagat ggttgtgacc cacaaggact       360
     caaggacaac agccagttct gcttgcaaag gatccgccaa ggtctggctt tttataagca       420
     cctgcttgac tctgacatct tcaaagggga gcctgctcta ctccctgata gccccatgga       480
     gcaacttcac acctccctac taggactcag ccaactcctc cagccagagg atcacccccg       540
     ggagacccaa cagatgccca gcctgagttc tagtcagcag tggcagcgcc cccttctccg       600
     ttccaagatc cttcgaagcc tccaggcctt tttggccata gctgcccggg tctttgccca       660
     cggagcagca actctgactg agcccttagt gccaacagct taaggatgcc caggttccca       720
     tggctaccat gataagacta atctatcagc ccagacatct accagttaat taacccatta       780
     ggacttgtgc tgttcttgtt tcgtttgttt tgcgtgaagg gcaaggacac cattattaaa       840
     gagaaaagaa acaaacccca gagcaggcag ctggctagag aaaggagctg gagaagaaga       900
     ataaagtctc gagcccttgg ccttggaagc gggcaagcag ctgcgtggcc tgaggggaag       960
     ggggcggtgg catcgagaaa ctgtgagaaa acccagagca tcagaaaaag tgagcccagg      1020
     ctttggccat tatctgtaag aaaaacaaga aaaggggaac attatacttt cctgggtggc      1080
     tcagggaaat gtgcagatgc acagtactcc agacagcagc tctgtacctg cctgctctgt      1140
     ccctcagttc taacagaatc tagtcactaa gaactaacag gactaccaat acgaactgac      1200
     aaatactacc actatgacct gtgacaaagc tgcatattta ttaagtggga agggaacttt      1260
     tgatattatt tatccttgta acagtataga tgatggttat ttattctatt tataaggaat      1320
     tatgtatttt tttttcaata aagatttatt tatgtggc                              1358
//