Dbfetch

ID   AF299339; SV 1; linear; mRNA; STD; MUS; 1428 BP.
XX
AC   AF299339;
XX
DT   11-DEC-2000 (Rel. 66, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus SIR2L3 isoform B (Sir2L3) mRNA, complete cds; alternatively
DE   spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1428
RX   DOI; 10.1006/geno.2000.6360.
RX   PUBMED; 11056054.
RA   Yang Y.H., Chen Y.H., Zhang C.Y., Nimmakayalu M.A., Ward D.C., Weissman S.;
RT   "Cloning and characterization of two mouse genes with homology to the yeast
RT   Sir2 gene";
RL   Genomics 69(3):355-369(2000).
XX
RN   [2]
RP   1-1428
RA   Yang Y.H., Chen Y.H., Zhang C.Y., Nimmakayalu M.A., Ward D.C., Weissman S.;
RT   ;
RL   Submitted (28-AUG-2000) to the INSDC.
RL   Department of Genetics, Yale Medical School, 333 Cedar Street, New Haven,
RL   CT 06536, USA
XX
DR   MD5; 025edcec56b78447d300eb5becd59b99.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1428
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="F4"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             250..1023
FT                   /codon_start=1
FT                   /gene="Sir2L3"
FT                   /product="SIR2L3 isoform B"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:Q8R104"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="MGI:MGI:1927665"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R104"
FT                   /protein_id="AAG39258.1"
FT                   /translation="MVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFH
FT                   NPKPFFMLAKELYPGHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVE
FT                   AHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCAVCTGVVKPDIVFFGEQLPARFLLH
FT                   MADFALADLLLILGTSLEVEPFASLSEAVQKSVPRLLINRDLVGPFVLSPRRKDVVQLG
FT                   DVVHGVERLVDLLGWTQELLDLMQRERGKLDGQDR"
XX
SQ   Sequence 1428 BP; 318 A; 373 C; 411 G; 326 T; 0 other;
     ggggattcgg atggcgcttg accctctagg cgccgtcgtc ctgcagagca tcatggcgct        60
     aagcggtcga ctggcattgg ccgcgctcag actgtggggt ccgggagtgt tacaggtggg       120
     agaaggccca tatccctctg tgtgggagcc tcaggcggct ttggaggtgg aggaagcagt       180
     gagaagaagt tttctctgca ggatgtagct gagctgcttc ggaccagagc ctgcagtagg       240
     gtggtggtca tggtgggggc cggcatcagc acacccagtg gcatcccgga cttcagatcc       300
     ccagggagcg gcctctacag caaccttcag cagtatgaca tcccgtaccc tgaagccatc       360
     tttgaacttg gctttttctt tcacaacccc aagccctttt tcatgttggc caaggagctg       420
     taccctgggc actacaggcc caatgtcact cactacttcc tgaggctcct ccacgacaag       480
     gagctgcttc tgcggctcta tacacagaac atcgacgggc ttgagagagc atctgggatc       540
     cctgcctcaa agctggttga agcccacggg acctttgtaa cagctacatg cacggtctgt       600
     cgaaggtcct tcccagggga agacatatgg gctgatgtga tggcggacag ggtgccccgc       660
     tgcgctgtct gtactggcgt tgtgaaaccc gacattgtgt tctttgggga gcagctgcct       720
     gcaaggttcc tactccatat ggctgacttc gctttggcag atctgctact cattcttggg       780
     acctccctgg aggtggagcc ttttgccagc ttgtctgaag cagtacagaa atcagtgccc       840
     cgactgctca tcaatcgaga cttggtgggg ccgttcgttc tgagtcctcg aaggaaagat       900
     gtggtccagc taggggatgt agttcatggt gtggaaaggc tggtggacct cctggggtgg       960
     acacaagaac tgctggatct tatgcagcgg gaacgtggca agctggatgg acaggacaga      1020
     taagactatg gcttcttcac ctggggaagt cacacagcag atcatcctat gtccagcaag      1080
     acttcatgcc tgaagacagc tccaacacgt ttacaaacat gaaccagacc acaacatgtg      1140
     gcctggacag tggtcctccg aggctgcctt tggaaaggct gaccagggat gtctaccctt      1200
     ggggcccctc catgtgtgcg ccctgtccac ctcatcactg ctgaaggtgt agtgcaggtg      1260
     ctgctttctg cagcggccct taagttatca cgagggcagc acagcacgcc cgtcgccagg      1320
     caggcgatgc actagggcaa tctagcatgt tgatcggtaa agtggcatct ttaactacaa      1380
     catcatttct tgcatgaaat aaacttagta taaaaaaaaa aaaaaaaa                   1428
//