Dbfetch

ID   AF299338; SV 1; linear; mRNA; STD; MUS; 1473 BP.
XX
AC   AF299338;
XX
DT   11-DEC-2000 (Rel. 66, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus SIR2L3 isoform A (Sir2L3) mRNA, complete cds; alternatively
DE   spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1473
RX   DOI; 10.1006/geno.2000.6360.
RX   PUBMED; 11056054.
RA   Yang Y.H., Chen Y.H., Zhang C.Y., Nimmakayalu M.A., Ward D.C., Weissman S.;
RT   "Cloning and characterization of two mouse genes with homology to the yeast
RT   Sir2 gene";
RL   Genomics 69(3):355-369(2000).
XX
RN   [2]
RP   1-1473
RA   Yang Y.H., Chen Y.H., Zhang C.Y., Nimmakayalu M.A., Ward D.C., Weissman S.;
RT   ;
RL   Submitted (28-AUG-2000) to the INSDC.
RL   Department of Genetics, Yale Medical School, 333 Cedar Street, New Haven,
RL   CT 06536, USA
XX
DR   MD5; da37f4e865022fc27b1945a60888ceed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1473
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="F4"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             295..1068
FT                   /codon_start=1
FT                   /gene="Sir2L3"
FT                   /product="SIR2L3 isoform A"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:Q8R104"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="MGI:MGI:1927665"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R104"
FT                   /protein_id="AAG39257.1"
FT                   /translation="MVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFH
FT                   NPKPFFMLAKELYPGHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVE
FT                   AHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCAVCTGVVKPDIVFFGEQLPARFLLH
FT                   MADFALADLLLILGTSLEVEPFASLSEAVQKSVPRLLINRDLVGPFVLSPRRKDVVQLG
FT                   DVVHGVERLVDLLGWTQELLDLMQRERGKLDGQDR"
XX
SQ   Sequence 1473 BP; 333 A; 385 C; 415 G; 340 T; 0 other;
     acttccgcta aacttctccc gggtttctgg ccctgccctt gaggcattaa agagtagagg        60
     tgcctgggga cagctagcca ctgactggtc acgtagcctc aagcctgcag acttgggtcc       120
     tctgaaaccg gatggcgttt ggcgaggact agtgttacag gtgggagaag gcccatatcc       180
     ctctgtgtgg gagcctcagg cggctttgga ggtggaggaa gcagtgagaa gaagttttct       240
     ctgcaggatg tagctgagct gcttcggacc agagcctgca gtagggtggt ggtcatggtg       300
     ggggccggca tcagcacacc cagtggcatc ccggacttca gatccccagg gagcggcctc       360
     tacagcaacc ttcagcagta tgacatcccg taccctgaag ccatctttga acttggcttt       420
     ttctttcaca accccaagcc ctttttcatg ttggccaagg agctgtaccc tgggcactac       480
     aggcccaatg tcactcacta cttcctgagg ctcctccacg acaaggagct gcttctgcgg       540
     ctctatacac agaacatcga cgggcttgag agagcatctg ggatccctgc ctcaaagctg       600
     gttgaagccc acgggacctt tgtaacagct acatgcacgg tctgtcgaag gtccttccca       660
     ggggaagaca tatgggctga tgtgatggcg gacagggtgc cccgctgcgc tgtctgtact       720
     ggcgttgtga aacccgacat tgtgttcttt ggggagcagc tgcctgcaag gttcctactc       780
     catatggctg acttcgcttt ggcagatctg ctactcattc ttgggacctc cctggaggtg       840
     gagccttttg ccagcttgtc tgaagcagta cagaaatcag tgccccgact gctcatcaat       900
     cgagacttgg tggggccgtt cgttctgagt cctcgaagga aagatgtggt ccagctaggg       960
     gatgtagttc atggtgtgga aaggctggtg gacctcctgg ggtggacaca agaactgctg      1020
     gatcttatgc agcgggaacg tggcaagctg gatggacagg acagataaga ctatggcttc      1080
     ttcacctggg gaagtcacac agcagatcat cctatgtcca gcaagacttc atgcctgaag      1140
     acagctccaa cacgtttaca aacatgaacc agaccacaac atgtggcctg gacagtggtc      1200
     ctccgaggct gcctttggaa aggctgacca gggatgtcta cccttggggc ccctccatgt      1260
     gtgcgccctg tccacctcat cactgctgaa ggtgtagtgc aggtgctgct ttctgcagcg      1320
     gcccttaagt tatcacgagg gcagcacagc acgcccgtcg ccaggcaggc gatgcactag      1380
     ggcaatctag catgttgatc ggtaaagtgg catctttaac tacaacatca tttcttgcat      1440
     gaaataaact tagtataaaa aaaaaaaaaa aaa                                   1473
//