spacer

EBI Dbfetch

ID   AF295105; SV 1; linear; mRNA; STD; MUS; 14904 BP.
XX
AC   AF295105;
XX
DT   23-NOV-2000 (Rel. 65, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus cardiac Ca2+ release channel mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-14904
RX   DOI; 10.1074/jbc.274.37.25971.
RX   PUBMED; 10473538.
RA   Zhao M., Li P., Li X., Zhang L., Winkfein R.J., Chen S.R.;
RT   "Molecular identification of the ryanodine receptor pore-forming segment";
RL   J Biol Chem 274(37):25971-25974(1999).
XX
RN   [2]
RP   1-14904
RA   Chen S.W.;
RT   ;
RL   Submitted (10-AUG-2000) to the INSDC.
RL   Physiology and Biophysics, University of Calgary, 3330 Hospital Drive N.W.,
RL   Calgary, AB T2N 4N1, Canada
XX
DR   MD5; af092e80f33b40b7368666568228b4e2.
DR   Ensembl-Gn; ENSMUSG00000021313; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021750; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..14904
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..14904
FT                   /codon_start=1
FT                   /product="cardiac Ca2+ release channel"
FT                   /note="ryanodine receptor"
FT                   /db_xref="GOA:E9Q401"
FT                   /db_xref="InterPro:IPR000699"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR003032"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR009460"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013333"
FT                   /db_xref="InterPro:IPR013662"
FT                   /db_xref="InterPro:IPR014821"
FT                   /db_xref="InterPro:IPR015925"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR018355"
FT                   /db_xref="MGI:MGI:99685"
FT                   /db_xref="PDB:2MC2"
FT                   /db_xref="PDB:3IM5"
FT                   /db_xref="PDB:3IM6"
FT                   /db_xref="PDB:3IM7"
FT                   /db_xref="PDB:3QR5"
FT                   /db_xref="PDB:4ETV"
FT                   /db_xref="PDB:4KEI"
FT                   /db_xref="PDB:4KEJ"
FT                   /db_xref="PDB:4KEK"
FT                   /db_xref="PDB:4L4H"
FT                   /db_xref="PDB:4L4I"
FT                   /db_xref="UniProtKB/Swiss-Prot:E9Q401"
FT                   /protein_id="AAG34081.1"
FT                   /translation="MADAGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNR
FT                   LCFLESTSNSKNVPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKT
FT                   AQGGGHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIH
FT                   PASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNSSWHVDAAFQQTLWSVAPISSGSE
FT                   AAQGYLIGGDVLRLLHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLR
FT                   VAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKNLLLMDKEKADVKSTAFAFRSSKEKLDV
FT                   GVRKEVDGMGTSEIKYGDSICYIQHVDTGLWLTYQAVDVKSARMGSIQRKAIMHHEGHM
FT                   DDGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKVKLPTIDLPIESVSLSLQD
FT                   LIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADV
FT                   AGREAGESWKSILNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLH
FT                   CVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDN
FT                   LLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLR
FT                   VGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDD
FT                   VISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFK
FT                   FLPPPGYAACYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTVSLTQAAFTPVPVDTSQ
FT                   IVLPPHLERIRERLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFCKLPEQERN
FT                   YNLQMSLETLKTLLALGCHVGIADEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLT
FT                   PSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKD
FT                   SLREAVRTLLGYGYHLEAPDQDHASRAEVCSGTGERFRIFRAEKTYAVKAGRWYFEFEA
FT                   VTAGDMRVGWSRPGCQPDLELGSDDRAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMV
FT                   DMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLK
FT                   YFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGTIDSSPCLK
FT                   VTQKSFGSQNNNTDIMFYRLSMPIECAEVFSKSVAGGLPGAGFYGPKSDLEDFDVDSDF
FT                   EVLMKTAHGHLVPDRIDKDKETPKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTGHS
FT                   ARLTEDVLAGDRDDYEYLMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDTGFDLDR
FT                   VRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNSNGLEIGCVVDAASGLLT
FT                   FIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNP
FT                   VPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENR
FT                   SVDILELTEQEELLQFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPG
FT                   LLRAGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDENKKHGLPGIGLST
FT                   SLRPRMRFSSPSFVSISNDCYQYSPEFPLDILKAKTIQMLTEAVKEGSLHARDPVGGTT
FT                   EFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAAVPEEEGGTPEKEISIEDA
FT                   KLEGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVA
FT                   KLQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDKSECPCPEEIR
FT                   DQLLDFHEDLMTHCGIELDEDGSLDGSNDLTIRGRLLSLVEKVTYLKKKQAEKPVASDS
FT                   RKCSSLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGV
FT                   SVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHET
FT                   VMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGL
FT                   ASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVARYLAGCGLQSCQMLVSKGYPD
FT                   IGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAA
FT                   MEEAIKIAEDPSRDGPSPTSGSSKTLDIEEEEDDTIHMGNAIMTFYAALIDLLGRCAPE
FT                   MHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGKVVEPDMSAGFCPDH
FT                   KAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTA
FT                   VLPLLTRCARLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRP
FT                   SMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLS
FT                   RKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGN
FT                   FNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKP
FT                   YKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSIDAA
FT                   HGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTL
FT                   TAKEKAKDREKAQDIFKFLQISGYVVSRGFKDLDLDTPSIEKRFAYSFLQQLIRYVDEA
FT                   HQYILEFDGGSRSKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCTGGH
FT                   ASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLDSVK
FT                   SALRAFLDNAAEDLEKTMENLKQGQFTHTRSQPKGVTQIINYTTVALLPMLSSLFEHIG
FT                   QHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPIAFLE
FT                   THLDKHNVYSIYNTRSSRERTALSLPANVEDVCPNIPSLEKLMTEIIELAESGIRYTQM
FT                   PYMMEVVLPMLCSYMSRWWEHGPENHPERAEMCCTALNSEHMNTLLGNILKIIYNNLGI
FT                   DEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMS
FT                   EAELLILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSK
FT                   SHNFKREEQNFVVQNEINNMSFLITDTKSKMSKAAISDQERKKMKRKGDRYSMQTSLIV
FT                   AALKRLLPIGLNICAPGDQELIALAKNRFSLKDTEEEVRDIIRSNIHLQGKLEDPAIRW
FT                   QMALYKDFPNRTEDPSDPERTVERVLGIANVLFHLEQKSKYTGRGYFSLVEHPQRSKKA
FT                   VWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDL
FT                   AKPGAELPEEDEAMKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEE
FT                   DDDGEEEVKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLG
FT                   IAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVT
FT                   EEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLR
FT                   VQESISDFYWYYSGKDIIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSR
FT                   LWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQ
FT                   MVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKH
FT                   YTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQ
FT                   TFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFD
FT                   VVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLNERLANKEESEKERPEEQAPRMG
FT                   FFSLLTIQSALFALRYNVLTLVRMLSLKSLKKQMKRMKKMTVKDMVLAFFSSYWSVFVT
FT                   LLHFVASVCRGFFRIVSSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGDEEEGERK
FT                   PLESALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMTNPVP
FT                   VPEVQEKFQEQKAKEEKEEKEETKSEPEKAEGEDGEKEEKAKDEKSKQKLRQLHTHRYG
FT                   EPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEG
FT                   KELPTRTSSDTAKVTNSLDSSPHRIIAVHYVLEESSGYMEPTLRILAILHTIISFFCII
FT                   GYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDK
FT                   FVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQ
FT                   MWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGK
FT                   QLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAG
FT                   GGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKED
FT                   METKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWK
FT                   MYQERCWEFFPAGDCFRKQYEDQLN"
XX
SQ   Sequence 14904 BP; 4033 A; 3480 C; 3893 G; 3498 T; 0 other;
     atggctgatg cgggcgaagg cgaggatgag atccagttcc tgagaactga tgatgaggtg        60
     gttctgcagt gcacggcgac catccacaaa gaacagcaga agctgtgctt ggcagcagaa       120
     ggatttggca acagactttg ttttttggag tctacttcca attccaagaa tgttcccccg       180
     gacctgtcta tctgcacctt tgtgctggag cagtccctgt cagtacgggc cctgcaggag       240
     atgctggcca acacagtgga aaagtcagaa gggcaggtgg atgtggaaaa gtggaagttc       300
     atgatgaaga ctgctcaagg tggaggccac cggacactcc tctatggaca cgccatattg       360
     ctacgccatt cctacagtgg tatgtatctt tgctgtctct ccacctcccg gtcttccact       420
     gacaaactgg ccttcgatgt tggccttcaa gaggatacca caggggaggc ttgctggtgg       480
     accatacatc ctgcctctaa gcagagatca gaaggagaaa aagtgcgtgt tggagacgat       540
     ctcatcttgg tcagcgtgtc ctcagaaagg tacttgcact tgtcatatgg caacagcagc       600
     tggcatgtgg atgctgcctt ccagcagacc ctctggagcg tggcccctat cagctcagga       660
     agtgaagcag cccaaggcta tctcattggt ggtgatgttc tccggctgct gcatgggcac       720
     atggatgaat gtctcactgt cccttcagga gagcatggcg aagaacagcg gagaacagtt       780
     cattatgaag gtggtgccgt atcagttcat gcccgctccc tctggagact agagacccta       840
     agagtcgcgt ggagtggaag ccacataaga tggggccagc cattccgact ccggcatgtc       900
     acgacaggaa aatacttaag cctcatggaa gacaagaacc tcttactcat ggacaaagag       960
     aaagcagatg taaaatcaac agcgtttgcc ttccggtctt ccaaggaaaa attggacgtg      1020
     ggggtgagga aagaagtcga tggcatggga acctcagaaa tcaagtatgg agactccatt      1080
     tgctacatac aacatgtgga tacaggcctg tggctaacct accaggctgt ggatgtgaaa      1140
     tcagcacgaa tgggatccat ccagcgtaag gctatcatgc accacgaagg ccacatggac      1200
     gatggtttga acttatccag atcgcagcat gaggagtccc gcactgcccg cgtcattcgg      1260
     agcacagtgt tcctctttaa taggttcata aggggcctgg atgctctcag caagaaagta      1320
     aagctgccca ccattgactt gcccatcgag tctgtgagcc tgagtttgca ggacctcatc      1380
     ggctacttcc accccccaga tgagcacttg gagcatgagg acaagcagaa caggctgcga      1440
     gccctgaaga acaggcagaa tctcttccag gaagagggaa tgatcaacct ggttctggag      1500
     tgcatcgacc gcctgcatgt ctacagcagt gcagcccact ttgcagatgt cgcaggacga      1560
     gaagcaggag agtcttggaa atccatcctg aattccctat atgagttgct ggcggcccta      1620
     attagaggaa atcgtaaaaa ctgtgctcag ttttctggtt ccctcgactg gctgatcagc      1680
     agactggaaa gactggaagc atcctcgggt atcctggagg tcctccactg tgtgttagtg      1740
     gagagcccag aagctctgaa tatcatcaaa gaagggcata tcaagtccat tatctcgctt      1800
     ttagacaagc atgggagaaa ccacaaggtc ctggatgtgc tgtgttctct ctgtgtatgc      1860
     catggagttg ctgtccgctc taatcagcac ctcatctgtg ataatctcct gccaggacga      1920
     gatctcttac tgcagacccg tcttgtgaat catgtcagca gcatgaggcc taatattttc      1980
     ctgggtgtca gcgaaggatc agcacagtat aagaagtggt actacgagct catggtggac      2040
     cacacggaac cctttgtgac ggcagaagcc actcacctgc gagtgggctg ggcttccact      2100
     gaagggtatt ctccataccc aggagggggt gaagagtggg gtggcaatgg cgttggtgac      2160
     gacctcttct cctatgggtt tgacggcctt cacctctggt caggttgtat agctcgaacc      2220
     gtgagctccc ccaaccagca cctgctgaga actgacgatg tcatcagttg ttgtttagat      2280
     ctaagtgccc ccagcatctc gtttcgcatt aatggacaac cggtgcaagg aatgtttgag      2340
     aacttcaata tcgatggcct gttctttcca gttgtcagtt tctctgcagg aataaaggtt      2400
     cgctttttgc ttggggggag acatggagaa ttcaagtttc tccctccacc tggctatgca      2460
     gcttgctatg aagctgtatt gcccaaagag aaattgaagg tggaacacag ccgagagtat      2520
     aagcaggaga ggacatacac acgagacctg ctgggtccta cagtgtccct gacccaagcc      2580
     gccttcacac ctgttcctgt ggacaccagc cagattgtgt tgcctcctca cctggaaagg      2640
     ataagagaaa gactggcaga gaatatccat gagctctggg ttatgaataa aattgagctt      2700
     ggctggcagt atggtccggt tagagatgac aacaagagac agcacccatg tctggtggag      2760
     ttctgcaagc ttccagaaca ggaacgcaac tataatttgc agatgtcgct tgaaaccctc      2820
     aagactttgc tggcattggg atgtcacgtg ggtatagctg atgaacatgc tgaagagaag      2880
     gtgaagaaaa tgaagctgcc caagaattac cagctgacca gcggatacaa gcctgcccca      2940
     atggatctga gctttataaa actaaccccg tctcaggaag caatggtgga caagttggct      3000
     gaaaatgctc acaatgtgtg ggcccgggac cgaatccggc aaggctggac ttacggcatc      3060
     cagcaggatg taaagaatag aagaaaccct cgtcttgtcc cctacactct tctggatgac      3120
     agaaccaaga agtccaacaa agacagtctc cgagaggcag tgcgcacact gctgggctac      3180
     ggctaccacc tggaagctcc tgatcaggac catgcctcga gagccgaggt gtgcagcggt      3240
     actggggaga ggttccgcat cttcagggca gagaagacct atgcggtgaa ggctgggcgc      3300
     tggtactttg aatttgaggc tgtcactgct ggagacatgc gggtgggctg gagcaggcca      3360
     ggctgccaac cagatctaga actgggttct gatgaccgtg cctttgcttt tgatggcttt      3420
     aaggcacagc ggtggcacca gggcaatgaa cactacgggc gctcatggca agctggtgac      3480
     gtcgtgggct gcatggttga tatgaatgaa cacaccatga tgttcactct gaacggcgag      3540
     atcctgctgg atgattcggg ctctgagctg gcattcaagg actttgatgt tggtgatgga      3600
     ttcatccctg tgtgtagcct cggggtggca caagtaggca ggatgaactt tggaaaggac      3660
     gtcagcactt tgaaatattt taccatctgt ggcttacaag aaggctatga gccatttgcc      3720
     gttaatacaa atagggacat caccatgtgg ctgagcaagc ggcttcctca gttcctccag      3780
     gtcccatcaa accacgaaca cattgaggtg accagaatag atggtaccat agacagttct      3840
     ccatgtctga aggtcactca gaagtccttt ggttctcaga acaacaacac tgacatcatg      3900
     ttttaccgcc tgagtatgcc cattgaatgt gccgaggtct tctcaaagtc ggtggcggga      3960
     gggcttcctg gtgccggctt ctacgggccc aagagtgatt tggaggactt tgatgtggac      4020
     tctgactttg aggttctgat gaagacagct catggtcatc ttgtgcctga ccgcatcgac      4080
     aaggacaaag agacccccaa gccagagttc aataaccaca aagattatgc tcaggaaaag      4140
     ccctcacgac taaagcaaag attcttactt cgaaggacca agccagatta cagcacaggc      4200
     cactctgcaa gactcactga agatgtcctt gctggtgacc gggatgacta cgagtacctg      4260
     atgcagacgt ccacatacta ttactcggtg aggatctttc ctggacaaga accagctaat      4320
     gtctgggtgg gctggattac atctgacttc caccagtacg acacaggctt cgacttggac      4380
     agagtgcgca cagtgacggt caccctagga gatgaaaaag gaaaagtgca tgagagcatc      4440
     aaacgcagca actgctatat ggtgtgtgct ggagagagca tgagccccgg gcaaggacga      4500
     aacaacagca acgggttgga gattggctgt gtggtggatg ctgccagtgg gctgctcaca      4560
     ttcatagcca atggcaagga gctaagcact tactatcagg tggagccaag cacaaagctc      4620
     tttcctgcgg ttttcgcgca agctacgagt cccaatgttt tccagtttga gttgggcaga      4680
     ataaagaatg taatgcctct ctccgcggga ctgtttaaga gcgagcacaa aaaccccgtg      4740
     ccccagtgtc ctccacgtct gcatgtgcag ttcctgtcac atgtcctgtg gagccggatg      4800
     cccaaccagt tcttgaaggt ggacgtctct cgaatcagtg aacgccaagg ctggctggtg      4860
     cagtgtctag atcctctgca gttcatgtcc ctccatatac ctgaggagaa cagatctgtt      4920
     gacatcttag agctgacaga gcaggaggag ttgctgcagt ttcactatca caccctccgc      4980
     ctctactctg ctgtctgcgc ccttgggaat catcgggtgg ctcacgccct gtgcagccac      5040
     gtggacgaac ctcagctgct ctacgccatt gagaacaagt acatgcctgg cttgctgcga      5100
     gctggctact atgacctgct gattgacatc cacctcagct cctatgccac cgccaggctc      5160
     atgatgaaca acgagttcat cgtccctatg acagaggaga caaagagcat caccctcttc      5220
     cctgatgaga acaagaagca tggcctccca ggcataggcc ttagcacctc cctccggcct      5280
     cggatgcgct tttcctcccc gagtttcgtg agcattagca acgactgtta tcagtacagt      5340
     cccgagtttc ccctggacat cctcaaggcc aagaccatcc agatgctcac agaagccgtg      5400
     aaggagggca gcctccatgc tcgggatcct gtgggtggga ccacggagtt cctctttgtg      5460
     cccctcatca agctgttcta caccctgctc atcatgggca tctttcacaa tgaggatttg      5520
     aaacacatcc tgcagttgat cgagcccagt gtgtttaagg aagctgccgt tccagaggag      5580
     gaaggaggca ccccggagaa ggagatcagt atagaagacg ccaagctgga aggcgaagaa      5640
     gaagccaaag ggggtaaaag gcccaaggaa ggcttgctcc agatgaaact cccggagcca      5700
     gttaaactac agatgtgcct cttgcttcag tacctctgtg actgccaggt taggcaccgg      5760
     atcgaagcca ttgtagcctt ttcagatgac tttgtagcta aactccaaga caaccaacgg      5820
     ttcaggtata atgaagtcat gcaagcctta aacatgtctg ccgcactcac tgccaggaaa      5880
     accaaggagt tccggtcacc accgcaggag cagattaaca tgcttctcaa ttttaaggat      5940
     gacaaaagtg aatgcccctg ccctgaagaa atccgagacc aactcctaga tttccacgag      6000
     gacctgatga ctcactgtgg aattgaactg gacgaggatg gatccctgga tggaagcaat      6060
     gacttaacaa tcagaggacg tctgttgtct ctggtagaaa aggtgaccta cctgaagaag      6120
     aagcaagctg aaaaaccagt tgcaagtgac tccagaaagt gctccagcct ccagcaactc      6180
     atttctgaga ctatggtacg gtgggctcaa gagtctgtca ttgaggaccc tgagctggtg      6240
     agggccatgt ttgtgctgct acatcggcag tatgatggca tcgggggtct agtccgagcg      6300
     ctgccaaaga cctacactat caacggggtc tctgtggagg acaccatcaa tctgcttgct      6360
     tcgcttggtc agatccgatc tctgctgagt gtgaggatgg gcaaagaaga ggagaagctg      6420
     atgatccgtg gactagggga tatcatgaat aacaaagtgt tttaccagca tcccaatctc      6480
     atgcgggccc ttgggatgca tgagacagtg atggaagtca tggtgaacgt ccttggaggt      6540
     ggcgagtcca aggaaatcac cttccccaag atggtggcca actgctgccg ttttctctgt      6600
     tacttctgtc gtataagtag acagaatcaa aaagccatgt ttgatcatct cagttactta      6660
     ctggaaaaca gcagtgttgg tcttgcatca ccagccatga gaggttcaac tcctttagac      6720
     gtggccgcag cttcagtgat ggataacaat gagcttgccc ttgctctacg agagccggat      6780
     ctggagaagg tagttgctcg ctatctggct ggctgtggtc tgcagagctg tcagatgctg      6840
     gtgtctaagg gttacccaga cattgggtgg aatccagttg aaggagagcg ataccttgac      6900
     tttctcagat ttgcagtctt ctgtaacggg gagagtgtgg aagagaatgc aaatgttgtg      6960
     gtgaggctgc tcatccggag acccgagtgc tttggtcctg ccttgagagg agaaggtggt      7020
     aatggtctcc ttgcagccat ggaagaagcc ataaaaatag ctgaggatcc ttctagagat      7080
     ggtccctctc caaccagtgg ctccagcaaa acccttgata tagaagagga ggaagatgat      7140
     accatccaca tggggaacgc gatcatgacc ttctacgcag ctttgattga cctgcttggt      7200
     cgctgtgctc ctgaaatgca cttgattcat gctggaaagg gagaagccat ccgaattagg      7260
     tccattttgc gatctctgat tccattggga gacttggtgg gtgtcatcag cattgcattt      7320
     cagatgccaa caatagccaa agatgggaag gtggtggagc ctgacatgtc cgcggggttt      7380
     tgcccagatc acaaggcagc catggttttg ttccttgaca gggtctatgg aattgaggtg      7440
     caagatttcc tcctccatct ccttgaggtt ggctttctgc cagatcttcg agctgctgcc      7500
     tctctagaca cggctgcact aagtgctaca gacatggcct tggccctcaa ccggtacctc      7560
     tgcacagctg tcctaccttt gttaacgagg tgtgctcgcc tgtttgctgg aacagagcac      7620
     catgcttccc tcattgactc tctgctacac actgtatata gactctctaa gggatgctcc      7680
     cttaccaaag ctcagcggga ctccatagaa gtgtgcctgc tctctatatg tggccaactg      7740
     agaccatcta tgatgcaaca cctactccga aggctggtgt ttgatgttcc actgttgaat      7800
     gagcatgcaa agatgcctct gaagctgctg accaatcatt atgaaagatg ctggaaatat      7860
     tattgcctcc ctggagggtg gggcaacttt ggtgctgcct cggaagaaga acttcattta      7920
     tcaagaaaat tattttgggg catctttgat gctttgtctc aaaagaaata tgaacaagaa      7980
     cttttcaaac tggccctgcc ttgcctgagt gcagttgcgg gagctttacc tccagactac      8040
     atggagtcaa actatgtcag tatgatggaa aaacagtcat ccatggattc tgaagggaac      8100
     tttaacccac aacctgttga tacctcaaac attacaattc ctgagaagtt ggaatacttc      8160
     attaacaaat atgcagaaca ttcccatgat aaatggtcca tggacaagtt ggcgaatgga      8220
     tggatttatg gggaaatata ttcagactct tctaagatcc aaccgctaat gaagccatat      8280
     aaactcttgt ctgaaaagga aaaagaaatt tatcgttggc caatcaagga gtctttgaaa      8340
     acgatgctgg cttggggttg gagaattgag agaacacggg agggggacag catggccctt      8400
     tataaccgga ctcgacgaat ttctcagaca agccaggtgt ctatagatgc tgcacatgga      8460
     tacagccccc gtgctattga catgagtaat gtgacactct ctcgagacct gcatgctatg      8520
     gcagagatga tggctgaaaa ctaccacaac atatgggcca agaaaaagaa actggagctg      8580
     gaatccaaag gaggaggaaa ccaccccctc ctggtgcctt atgacacact gacagccaag      8640
     gagaaagcca aggacagaga aaaagcccaa gacatcttca agttcctaca gatcagtggt      8700
     tatgtggtat ccagagggtt caaagacctg gatctagata caccttcgat tgagaagcga      8760
     tttgcctata gtttcctgca gcagctgatc cgatacgtgg atgaggcgca tcagtacatc      8820
     ctggagtttg atggtggcag cagaagcaaa ggagaacact tcccgtacga gcaagaaatc      8880
     aagttctttg ccaaagttgt tcttccttta attgatcagt atttcaaaaa ccaccgcctg      8940
     tacttcttgt ctgctgcaag caggcctctc tgcactggag gacatgcatc caacaaagag      9000
     aaggagatgg tgacaagcct gttctgcaaa cttggagttc ttgtcaggca taggatctca      9060
     ctgtttggga atgatgccac ctcaattgtg aactgtctgc acattttggg tcagactttg      9120
     gatgcaagga ctgtgatgaa gacgggccta gacagtgtga aaagtgctct tagggccttt      9180
     ctggacaatg ctgcagagga tttggaaaag acaatggaaa acctgaagca gggccagttt      9240
     actcacacca ggagccagcc caagggggtg actcagatca tcaactacac cactgtggct      9300
     ctcctgccca tgctctcctc cctgtttgaa cacatcggcc agcatcagtt tggagaagat      9360
     ctgatattgg aggatgtaca ggtgtcttgt tatagaatcc tgaccagctt gtatgccctg      9420
     ggaaccagca agagcatcta cgtggagagg caacgatctg cacttgggga atgcttagct      9480
     gcctttgctg gtgccttccc tatcgccttt ttggaaactc acctggacaa acataatgtt      9540
     tactccatct acaacaccag atcttcacga gaaagaacag ctctcagttt acctgcaaat      9600
     gtggaggatg tctgcccaaa tataccatcc ctggagaagc ttatgactga gattatagag      9660
     ctggcagagt caggaatccg ctacactcag atgccataca tgatggaggt tgtactgccc      9720
     atgttatgca gctacatgtc aaggtggtgg gaacacggtc ctgagaacca tccagagagg      9780
     gctgagatgt gctgcacagc cctcaactca gagcacatga acacgctgct gggcaacatt      9840
     ctcaaaatca tctacaacaa cctggggatt gatgaaggag cctggatgaa gcgcttggcc      9900
     gtgttttcac agcctatcat caacaaagtg aaacctcagc tcttgaaaac tcatttctta      9960
     cccttgatgg agaagctaaa gaaaaaggct gctatggtag tgtctgagga agaccacctg     10020
     aaagccgaag ccagagggga catgtctgag gccgagctgc tcattctaga tgagttcacc     10080
     acactggcca gggatctcta tgccttctac ccactcctga tccgatttgt ggactataac     10140
     agggcaaagt ggctgaagga gcccaaccca gaagcagagg agctatttcg aatggtggct     10200
     gaagtcttca tctactggtc caaatcccat aatttcaaaa gagaagaaca gaactttgtg     10260
     gtgcagaatg aaatcaacaa catgtccttc ctcatcactg acacaaagtc caagatgtcc     10320
     aaggcagcca tttctgatca agaaaggaag aaaatgaagc gcaaagggga ccggtattct     10380
     atgcagacat ctttgatcgt ggcagctctg aagagattac tacccattgg gctgaacatc     10440
     tgtgcccctg gtgaccaaga gctcattgct ttggccaaaa atagatttag cttgaaagac     10500
     accgaggagg aagtacgtga tataatccgc agtaatatac acttacaagg caagctggaa     10560
     gaccctgcaa tcaggtggca gatggctctc tacaaagact tcccgaacag gacagaagac     10620
     ccctcagacc cagagaggac agtcgagcgt gtcctgggta tagcaaatgt gctttttcac     10680
     cttgagcaga aatctaagta tactggccgg ggatatttca gcctggtgga acatcctcaa     10740
     agatcaaaga aagctgtgtg gcacaaacta ctctctaagc agagaaaaag agctgttgtg     10800
     gcctgcttcc ggatggcccc cttgtacaat ctgccaaggc atcgggcggt caatcttttt     10860
     cttcagggat atgaaaagtc ttggattgaa acagaagaac attactttga ggataaattg     10920
     attgaagatt tagcgaaacc tggggctgag ctcccagaag aagatgaagc catgaaaagg     10980
     gttgatcccc tccatcaact tattcttctg ttcagccgca cagccctaac ggagaaatgc     11040
     aaactggagg aagattttct atacatggcg tatgcagaca ttatggcaaa gagttgtcac     11100
     gatgaagaag atgatgatgg tgaagaagaa gtgaagagct ttgaagaaaa ggaaatggaa     11160
     aagcagaaac ttctgtacca gcaagccaga ctgcatgacc gcggggcagc agagatggtc     11220
     ctgcagacta tcagtgccag caaaggtgaa actggaccaa tggtggctgc tactttgaag     11280
     ctgggcattg cgattttaaa tggtggcaac tccacggtgc agcagaagat gctggattac     11340
     ctgaaggaaa aaaaggatgt aggcttcttc cagagtctgg ctggcctcat gcagtcctgc     11400
     agtgtcctgg acctgaatgc atttgagaga caaaacaaag cagaaggact tgggatggtg     11460
     actgaggaag gatcagggga gaaggttctg caggatgacg agttcacctg tgacctcttc     11520
     cgattcctgc agctgctttg tgaggggcac aactcagact ttcagaatta cctgagaact     11580
     cagaccggca acaacaccac agttaatatc atcatctcta ctgtggacta cctccttcga     11640
     gtgcaggagt ccattagtga tttctattgg tactactctg gcaaggacat catagatgag     11700
     caggggcagc gtaacttttc caaagccatt caagtggcga agcaggtgtt caacacgctc     11760
     acggagtaca tccagggccc ttgtactgga aatcagcaga gcctggcaca cagcaggctg     11820
     tgggatgctg ttgtgggctt ccttcatgta tttgcacaca tgcaaatgaa gctgtctcag     11880
     gattccagcc agattgagct cttaaaagaa cttatggatc tccagaagga catggtggtc     11940
     atgctgctgt ctatgctaga aggtaatgtg gtgaacggaa caataggcaa acagatggtg     12000
     gacatgcttg tggagtcgtc caacaacgtg gagatgatcc tcaagttctt tgacatgttt     12060
     ctgaagctga aggacttaac atcctctgac acattcaaag agtatgaccc tgatggcaaa     12120
     ggggtcattt ccaagagaga cttccacaaa gccatggaga gccacaagca ctacacccag     12180
     tcagagactg agttcctgct gtcctgtgca gagacagatg aaaacgagac acttgactat     12240
     gaagagtttg tcaagaggtt ccatgagcct gccaaggaca tcggcttcaa cgtggctgtt     12300
     ctgctgacca acctctcaga gcacatgccc aatgacacga ggctgcagac cttcttggag     12360
     ttggcagaga gtgtcctcaa ctacttccaa cctttcctgg gtcgcattga gatcatgggc     12420
     agtgccaagc gcatcgaaag ggtctatttt gagatcagcg aatccagccg aacccagtgg     12480
     gagaaacccc aggttaagga gtccaagagg cagttcatat tcgatgtggt caatgagggc     12540
     ggggagaagg agaagatgga gctctttgtg aacttctgtg aggacaccat ctttgagatg     12600
     cagttggcag ctcagatctc agagtctgat ctgaatgaga ggttggcgaa taaagaagag     12660
     agtgagaagg agaggccaga ggagcaggcc ccacgaatgg gcttcttctc cctcctcacc     12720
     atccagtcag ccctgtttgc tctcaggtac aatgtcctaa ccctcgtgag gatgctcagc     12780
     ctgaagagcc tgaagaagca gatgaagagg atgaagaaga tgacagtgaa ggacatggtc     12840
     ttggccttct tctcatccta ctggagtgtg tttgtcaccc tcttgcactt cgtggccagt     12900
     gtctgcaggg gcttctttcg cattgtctcc agcctgttgc tggggggcag cctggtggaa     12960
     ggtgctaaga aaatcaaagt ggcagaactt ctagctaaca tgccagaccc cactcaggat     13020
     gaggtgcgag gagatgagga ggagggagag aggaagcctt tagagtcagc cctgccctct     13080
     gaagacctga cagacttgaa ggaactgaca gaggagagtg atcttctttc tgacatattc     13140
     ggcttggatc tgaagagaga aggagggcag tacaaactaa ttcctcacaa cccaaatgcc     13200
     ggcctcagtg acctcatgac caaccctgtc cctgtccctg aggtacaaga aaagtttcag     13260
     gagcagaagg cgaaagagga aaaggaagaa aaggaagaaa ccaagtcgga accagagaaa     13320
     gctgaagggg aggatggaga aaaagaagaa aaagccaaag atgagaagag caaacagaag     13380
     ttgaggcagc ttcatacaca tcgctatggg gagccagaag tccctgagtc agcattctgg     13440
     aagaaaatca tagcctacca acagaagctg ctgaactatt ttgctcgaaa cttttacaat     13500
     atgagaatgc tggccttgtt tgttgccttc gccatcaatt tcatcctgct cttctacaag     13560
     gtctccactt cttctgtggt tgaaggaaag gagctgccta cccgaacctc cagcgatact     13620
     gctaaagtga ccaacagcct agacagcagc ccccacagga tcattgcggt tcactatgtc     13680
     ctggaggaga gcagcggcta catggaaccc accctgcgca tcttagccat cctccacacc     13740
     atcatctcct tcttttgcat catcggatac tactgcttga aagtcccctt ggttattttt     13800
     aagcgagaga aggaagtggc acggaagttg gagtttgacg gactttatat aacagagcag     13860
     ccttcggaag atgatatcaa aggccagtgg gacagacttg tgatcaacac acagtcattt     13920
     cccaataact actgggataa atttgtgaaa agaaaggtaa tggataaata tggagagttt     13980
     tatgggagag acagaatcag tgagttactg ggcatggata aggctgcact agatttcagc     14040
     gatgcaagag agaagaagaa gcccaaaaaa gacagctcct tgtctgctgt attgaattct     14100
     attgacgtga agtaccagat gtggaaactt ggagtcgtgt tcacagacaa ttccttcctc     14160
     tacctagcct ggtacatgac catgtctgtt cttggacatt ataacaactt tttttttgct     14220
     gctcacctcc ttgacatcgc gatgggattc aagaccttga gaactatcct gtcctcagtt     14280
     acccataatg gcaaacagct cgtgttaact gttggcttat tggctgttgt tgtatacctg     14340
     tacactgtcg tggcgttcaa tttcttccga aaattctaca ataaaagtga ggatggtgac     14400
     acgccggaca tgaagtgtga tgacatgctg acgtgttaca tgttccacat gtatgtgggc     14460
     gtccgtgctg gagggggcat tggtgatgaa attgaagacc cagcaggaga cgagtatgag     14520
     atctaccgca tcatctttga catcacattc ttcttcttcg tgattgtcat ccttttggct     14580
     atcatacaag gtttgatcat tgatgctttt ggagaactca gagaccaaca agagcaagtc     14640
     aaggaagaca tggagaccaa gtgcttcatc tgtgggattg gcaacgatta ttttgataca     14700
     gtgccacatg gctttgaaac ccatacttta caggaacaca acctggccaa ctacctgttt     14760
     tttctgatgt atctcataaa caaggatgaa acagaacaca caggacagga atcttacgtc     14820
     tggaagatgt accaagagag gtgttgggaa tttttcccag caggggactg tttccggaaa     14880
     cagtatgaag accagttaaa ttag                                            14904
//


spacer
spacer