spacer

EBI Dbfetch

ID   AF295097; SV 1; linear; mRNA; STD; MUS; 689 BP.
XX
AC   AF295097;
XX
DT   05-SEP-2000 (Rel. 65, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus twisted gastrulation protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-689
RA   Li J.M., Sha J.H., Zhou Z.M.;
RT   "Mouse twisted gastrulation protein: a new signal pathway of
RT   spermatogenesis";
RL   Unpublished.
XX
RN   [2]
RP   1-689
RA   Li J.M., Sha J.H., Zhou Z.M., Cheng Q., Cheng H.H., Zhu H., Zhou H.,
RA   Wang L.L., Shang Y.X., Li M.;
RT   ;
RL   Submitted (10-AUG-2000) to the INSDC.
RL   Key Lab of Reproductive Medicine, Nanjing Medical University, Han Zhong
RL   Road 140, Nanjing, Jiangsu 210029, China
XX
DR   MD5; 427fc2a16d6bea9dbdf8eac65765a9c7.
DR   Ensembl-Gn; ENSMUSG00000024098; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024906; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..689
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             14..685
FT                   /codon_start=1
FT                   /product="twisted gastrulation protein"
FT                   /note="involved in molecular signalling during
FT                   spermatogenesis; high level of expression at 4 week stage;
FT                   similar to Homo sapiens twisted gastrulation protein;
FT                   BMP-binding protein"
FT                   /db_xref="GOA:Q9EP52"
FT                   /db_xref="InterPro:IPR006761"
FT                   /db_xref="MGI:MGI:2137520"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EP52"
FT                   /protein_id="AAG10080.1"
FT                   /translation="MKSHYIAVLALASLTFLLCLPVSQSCNKALCASDVSKCLIQELCQ
FT                   CRPGEGNCPCCKECMLCLGALWDECCDCVGRCNPRNYSDTPPTSKSTVEELHEPIPSLF
FT                   RALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDK
FT                   ERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECMRPECIDYGSKTVKCMNCM
FT                   F"
XX
SQ   Sequence 689 BP; 157 A; 200 C; 178 G; 154 T; 0 other;
     tctttgaaga accatgaagt cacactatat tgctgtgcta gctctagcct ccctgacgtt        60
     cctgctgtgt ctccccgtgt cccagagctg taacaaagca ctctgtgcca gcgatgtgag       120
     caaatgcctc attcaggagc tctgccagtg ccggcctgga gaagggaact gcccctgctg       180
     taaggagtgc atgctgtgcc tcggggccct gtgggacgag tgctgcgact gtgtcggtag       240
     gtgcaaccct cggaattaca gcgacacccc gcccacatcc aagagcaccg tggaggagct       300
     gcacgagccc attccgtccc tgttcagggc gctgacggag ggcgacaccc agctgaactg       360
     gaacatcgtc tccttccctg tggcagagga gctgtcacat catgaaaacc tagtctcctt       420
     cctagaaact gtgaaccagc tgcaccacca aaacgtgtct gttcccagca acaatgtcca       480
     cgcccccttc cccagcgaca aagagcgcat gtgcacagtg gtttactttg atgactgcat       540
     gtccatccac cagtgtaaga tatcctgcga atccatgggt gcatccaagt atcgctggtt       600
     tcacaacgcc tgctgcgagt gcatgcgtcc agagtgcatt gactatggga gtaaaactgt       660
     caagtgtatg aactgcatgt tttaaagag                                         689
//


spacer
spacer