spacer

EBI Dbfetch

ID   AF292033; SV 1; linear; mRNA; STD; MUS; 1879 BP.
XX
AC   AF292033;
XX
DT   17-AUG-2000 (Rel. 64, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus twisted gastrulation protein (Tsg) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1879
RA   Zakin L., Oelgeschlager M., Geissert D., De Robertis E.M.;
RT   "Characterization of the mouse homolog of Twisted Gastrulation";
RL   Unpublished.
XX
RN   [2]
RP   1-1879
RA   Zakin L., Oelgeschlager M., Geissert D., De Robertis E.M.;
RT   ;
RL   Submitted (01-AUG-2000) to the INSDC.
RL   Biological Chemistry, HHMI/UCLA, 675 Charles E. Young Drive South, Los
RL   Angeles, CA 90024, USA
XX
DR   MD5; b0565257ca62e5465e6fbdfd0e38f972.
DR   Ensembl-Gn; ENSMUSG00000024098; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024906; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1879
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             98..766
FT                   /codon_start=1
FT                   /gene="Tsg"
FT                   /product="twisted gastrulation protein"
FT                   /note="secreted BMP-binding protein"
FT                   /db_xref="GOA:Q9EP52"
FT                   /db_xref="InterPro:IPR006761"
FT                   /db_xref="MGI:MGI:2137520"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EP52"
FT                   /protein_id="AAG00605.1"
FT                   /translation="MKSHYIVLALASLTFLLCLPVSQSCNKALCASDVSKCLIQELCQC
FT                   RPGEGNCPCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFR
FT                   ALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQLHHQNVSVPSNNVHAPFPSDKE
FT                   RMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
FT                   "
XX
SQ   Sequence 1879 BP; 479 A; 489 C; 475 G; 436 T; 0 other;
     ccacgcgtcc gcgcgggagc tgcttggagg ctcggcggcc gggaggaggc cggggccacg        60
     cttcttggaa gctactgagt gacttctttg aagaaccatg aagtcacact atattgtgct       120
     agctctagcc tccctgacgt tcctgctgtg tctccccgtg tcccagagct gtaacaaagc       180
     actctgtgcc agcgatgtga gcaaatgcct cattcaggag ctctgccagt gccggcctgg       240
     agaagggaac tgcccctgct gtaaggagtg catgctgtgc ctcggggccc tgtgggacga       300
     gtgctgcgac tgtgtcggta tgtgcaaccc tcggaattac agcgacaccc cgcccacatc       360
     caagagcacc gtggaggagc tgcacgagcc cattccgtcc ctgttcaggg cgctgacgga       420
     gggcgacacc cagctgaact ggaacatcgt ctccttccct gtggcagagg agctgtcaca       480
     ccatgaaaac ctagtctcct tcctagaaac tgtgaaccag ctgcaccacc aaaacgtgtc       540
     tgttcccagc aacaatgtcc acgccccctt ccccagcgac aaagagcgca tgtgcacagt       600
     ggtttacttt gatgactgca tgtccatcca ccagtgtaag atatcctgcg aatccatggg       660
     tgcatccaag tatcgctggt ttcacaacgc ctgctgcgag tgcatcggtc cagagtgcat       720
     tgactatggg agtaaaactg tcaagtgtat gaactgcatg ttttaaagag ggggaagaaa       780
     tgcaaaccaa agcaagaacg ctgacgatgc cgttgacact cctaccttgc aggatgtccc       840
     cacagagtcc actggaccag cttgtacaag ggtgaaacct ttctgcgtca cctttctgct       900
     tttgcagagc catgacagca gctgccttac agcgtgattt agcagacaga cctgacaggt       960
     gtgtcatgtg acaggcagcc atcagggtgg cctagcacat ttgtgggtgc tgatgttgta      1020
     ttgcactgtc aaagactgac cagtcctgat agggctggaa agaggaaagg ggtgtgggaa      1080
     ggtgactttc ttagctctcc cgtagcagca cactgtcata gtgtctcagt gtcatattgc      1140
     tgtgaagaga caccacaacc aaggcagctt atgaagaaag cccttaatta gggctcgctt      1200
     tacagttccg aggttacttc ctggtcgtcg tggtggggat gaggcagtag gtagcaggca      1260
     tggtgctgga gcagtagctg aatgttggtt cacaaactta gcacctcgag tcatgataga      1320
     aacaccatcc aggccttgaa gcccaacacg tagcaacacc acttgccaaa gcaggatcaa      1380
     ggctctgtca gcgtcccagg atgcagttgg gcaagttctt gagtgaaatt cctatacata      1440
     ctaactctgc aattttgctt ctatagttcc tcttcttgtt aactatatgt ccagaaccat      1500
     ttcagaatat gggtttttgt gaataaaaaa aataaaaagg cctggtctgc atagattggg      1560
     caagttccct tgcagccaca ggctaacagt aaagactttc tatttggctt taggagtatc      1620
     caaggggtgg tctctcgtga gagtacctcg caacagcagc agatggtgtt ggaggcttgg      1680
     cctgctgtgg gcttttgaaa ccttaaagtc cacccccagt gacacgcctc ctccaataac      1740
     accacacctc ctaatccttt ctaagtagtc cctcaactgg gaaccaagca ttcagatata      1800
     cgagcccaca aaggccattc tcgttcaaac caccacatgt aataaaatat atgccacgtc      1860
     aaaaaaaaaa aaaaaaaaa                                                   1879
//


spacer
spacer