spacer

EBI Dbfetch

ID   AF286725; SV 1; linear; mRNA; STD; MUS; 1038 BP.
XX
AC   AF286725;
XX
DT   02-AUG-2000 (Rel. 64, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus platelet-derived growth factor C (Pdgfc) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1038
RX   DOI; 10.1016/S0925-4773(00)00425-1.
RX   PUBMED; 10960785.
RA   Ding H., Wu X., Kim I., Tam P.P.L., Koh G.Y., Nagy A.;
RT   "The mouse Pdgfc gene: dynamic expression in embryonic tissues during
RT   organogenesis";
RL   Mech. Dev. 96(2):209-213(2000).
XX
RN   [2]
RP   1-1038
RA   Ding H., Wu X., Tam P.P.L., Nagy A.;
RT   ;
RL   Submitted (12-JUL-2000) to the INSDC.
RL   Samuel Lunenfeld Research Institute, Mount Sinai Hospital, 600 University
RL   Avenue, Toronto, Ontario M5G 1X5, Canada
XX
DR   MD5; 72d38fbfe3030538e5a5b0f709623d6b.
DR   Ensembl-Gn; ENSMUSG00000028019; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029652; mus_musculus.
DR   EuropePMC; PMC1316961; 16314518.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1038
FT                   /organism="Mus musculus"
FT                   /strain="Swiss-Webster/NIH"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1038
FT                   /codon_start=1
FT                   /gene="Pdgfc"
FT                   /product="platelet-derived growth factor C"
FT                   /note="PDGFC; similar to PDGF/VEGF"
FT                   /db_xref="GOA:Q8CI19"
FT                   /db_xref="InterPro:IPR000072"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:1859631"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CI19"
FT                   /protein_id="AAF91483.1"
FT                   /translation="MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPR
FT                   HERVVTISGNGSIHSPKFPHTYPRNMVLVWRLVAVDENVRTQLTFDERFGLEDPEDDIC
FT                   KYDFVEVEEPSDGSVLGRWCGSETVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSII
FT                   MPQVTETTSPSVLPPSSLSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQL
FT                   LGKAFLYVKKSKVVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTRFWPGCLLVKRCG
FT                   GNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCR
FT                   GNAGG"
XX
SQ   Sequence 1038 BP; 287 A; 230 C; 274 G; 247 T; 0 other;
     atgctcctcc tcggcctcct cctgctgaca tctgccctgg ccggccaaag aacggggact        60
     cgggctgagt ccaacctgag cagcaagttg cagctctcca gcgacaagga acagaacgga       120
     gtgcaagatc cccggcatga gagagttgtc actatatctg gtaatgggag catccacagc       180
     ccgaagtttc ctcatacata cccaagaaat atggtgctgg tgtggagatt agttgcagta       240
     gatgaaaatg tgcggaccca gctgacattt gatgagagat ttgggctgga agacccagaa       300
     gacgatatat gcaagtatga ttttgtagaa gttgaggagc ccagtgatgg aagtgtttta       360
     ggacgctggt gtggttctga gactgtgcca ggaaagcaga cttctaaagg aaatcatatc       420
     aggataagat ttgtatctga tgagtatttt ccatctgaac ccggattctg catccactac       480
     agtattatca tgccacaagt cacagaaacc acgagtcctt cggtgttgcc cccttcatct       540
     ttgtcattgg acctgctcaa caatgctgtg actgccttca gtaccttgga agagctgatt       600
     cggtacctag agccagatcg atggcaggtg gacttggaca gcctctacaa gccaacatgg       660
     cagcttttgg gcaaggcttt cctgtatgtg aaaaaaagca aagtggtgaa tctgaatctc       720
     ctcaaggaag aggtaaaact ctacagctgc acaccccgga acttctcagt gtccatacgg       780
     gaagagctaa agaggacaga taccagattc tggccaggtt gtctcctggt caagcgctgt       840
     ggaggaaatt gtgcctgttg tctccataat tgcaatgaat gtcagtgtgt cccacgtaaa       900
     gttacaaaaa agtaccatga ggtccttcag ttgagaccaa aaactggagt caagggattg       960
     cataagtcac tcactgatgt ggctctggaa caccacgagg aatgtgactg tgtgtgtaga      1020
     ggaaacgcag gagggtaa                                                    1038
//


spacer
spacer