spacer

EBI Dbfetch

ID   AF282844; SV 1; linear; mRNA; STD; MUS; 1880 BP.
XX
AC   AF282844;
XX
DT   02-OCT-2000 (Rel. 65, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus matrix metalloproteinase 16 (Mmp16) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1880
RA   Budde P., Gatsios P., Nienaber N.T., Li H., Staege M.S., Graeve L.,
RA   Heinrich P.C., Frey J.;
RT   "Differential localization and Triton X-100 solubility of membrane-type
RT   matrix metalloproteinases 1-3";
RL   Unpublished.
XX
RN   [2]
RP   1-1880
RA   Budde P., Frey J.;
RT   ;
RL   Submitted (26-JUN-2000) to the INSDC.
RL   Faculty of Chemistry/Biochemistry II, University of Bielefeld,
RL   Universtaetsstrasse 25, Bielefeld 33615, Germany
XX
DR   Ensembl-Gn; ENSMUSG00000028226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029881; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1880
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             7..1830
FT                   /codon_start=1
FT                   /gene="Mmp16"
FT                   /product="matrix metalloproteinase 16"
FT                   /note="MMP16; membrane type 3 matrix metalloproteinase"
FT                   /db_xref="GOA:Q9WTR0"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR016293"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR021805"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028697"
FT                   /db_xref="MGI:MGI:1276107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTR0"
FT                   /protein_id="AAG17704.1"
FT                   /translation="MILLAFSSGRRLDFVHRSVVFFLQTLLWILCATVCGTEQYFNVEV
FT                   WLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVP
FT                   DQTRGSSKFNIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVT
FT                   PLTFEEVPYSELENGKRDVDITIIFASGFHGDRSPFDGEGGFLAHAYFPGPGIGGDTHF
FT                   DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND
FT                   DLQGIQKIYGPPDKIPPPTRPLPTVPPHRSVPPADPRRHDRPKPPRPPTGRPSYPGAKP
FT                   NICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS
FT                   DGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDR
FT                   YWRYSEEMKTMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKV
FT                   EPGYPRSILKDFMGCDGPTDRDKEGLSPPDDVDIVIKLDNTASTVKAIAIVIPCILALC
FT                   LLVLVYTVFQFKRKGTPRHILYCKRSMQEWV"
XX
SQ   Sequence 1880 BP; 525 A; 442 C; 430 G; 483 T; 0 other;
     ttcactatga tcttactcgc attcagctct ggaagaaggt tggatttcgt gcatcgttcg        60
     gtggtgtttt tcttgcaaac cttgctttgg attttatgtg ctacagtctg cggaacggag       120
     cagtatttca atgtggaggt ttggttacaa aaatacggct accttccacc gactgacccc       180
     agaatgtcag tgctgcgctc tgcagagacc atgcagtcag ctctagctgc catgcagcag       240
     ttctatggca ttaacatgac aggaaaagtg gacagaaaca caatcgactg gatgaagaag       300
     cctcgatgcg gtgtaccaga ccagacaaga ggcagctcta aattcaacat ccgacgaaag       360
     cgctatgcat taactgggca gaagtggcaa cacaagcata tcacttacag tataaagaac       420
     gtaactccaa aagttggaga tcctgagacc cggagagcaa ttcgccgtgc ctttgatgtg       480
     tggcagaatg taactcctct aacgtttgaa gaagttccct acagtgaact agaaaatggc       540
     aaacgtgatg tggatataac catcattttt gcttctggtt tccatggaga cagatccccc       600
     tttgatgggg agggaggatt tttggcccat gcttatttcc ctgggccagg aattggaggc       660
     gatactcatt ttgattctga tgagccatgg acactgggaa atcccaatca tgatggaaac       720
     gatttatttc ttgtagcagt ccatgagctg ggacatgctc tagggctgga acattccaac       780
     gacccaaccg ctatcatggc cccattttat cagtacatgg aaacagacaa cttcaagctt       840
     cctaatgatg atttacaggg catccagaag atatatggtc cacctgacaa gatccctcca       900
     cctacaagac ctctaccgac agtgcccccg caccgatctg ttcctccagc agacccaagg       960
     agacatgaca ggcccaaacc tcctcggcct cccactggca gaccctccta tccaggagcc      1020
     aaacccaaca tctgtgatgg gaacttcaac actctagcta ttcttcgaag ggagatgttt      1080
     gttttcaagg accagtggtt ttggcgagtg agaaacaaca gggtgatgga tggataccca      1140
     atgcaaatta cttacttctg gcggggcctt cctcccagta ttgatgcagt ttatgaaaac      1200
     agtgacggaa atttcgtctt ctttaaaggc aacaaatact gggtgttcaa agacacaact      1260
     cttcaacctg gttaccctca tgacttgatt acccttggga atggaatccc ccctcatggt      1320
     attgattctg ccatatggtg ggaggatgtt ggcaaaacct atttcttcaa aggtgacagg      1380
     tattggagat atagtgaaga aatgaaaacc atggaccctg gttaccccaa gcccatcacc      1440
     atctggaagg ggatccctga atcacctcag ggagctttcg tccacaaaga aaatggcttt      1500
     acctatttct acaaaggaaa ggagtattgg aaattcaaca atcagatact caaagtagaa      1560
     cctggttatc caagatccat cctcaaggac tttatgggct gtgatggacc aacagaccga      1620
     gataaagaag gactcagccc accagatgat gtagacattg tcatcaaact ggacaacaca      1680
     gccagcactg tgaaagccat agctattgtc attccctgca tcttggcctt atgcctcctt      1740
     gtattggttt acactgtgtt ccagttcaag aggaaaggaa caccccgcca catactgtac      1800
     tgtaaacgct ctatgcaaga gtgggtgtga tgtagggatt tcttttttct ttcttttctg      1860
     ggagtttgtg gtaacttgag                                                  1880
//


spacer
spacer