spacer

EBI Dbfetch

ID   AF279436; SV 1; linear; mRNA; STD; MUS; 2598 BP.
XX
AC   AF279436;
XX
DT   18-JUL-2000 (Rel. 64, Created)
DT   18-JUL-2000 (Rel. 64, Last updated, Version 1)
XX
DE   Mus musculus lymphocyte receptor beta (LR-beta) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2598
RA   Donaldson D.D., Whitters M.J., Fitz L., Unger M., Finnerty H.,
RA   Dagdigian C., Lowe L., Wood C.R., Young D.A., Collins M.;
RT   "Chromosome 16p12 Encodes a Biologically Active IL-2Rb Related Receptor
RT   with Lymphoid Restricted Expression";
RL   Unpublished.
XX
RN   [2]
RP   1-2598
RA   Whitters M.J., Donaldson D.D., Unger M., Finnerty H.;
RT   ;
RL   Submitted (16-JUN-2000) to the INSDC.
RL   Immunology, Genetics Institute, 87 CambridgePark Dr., Cambridge, MA 02140,
RL   USA
XX
DR   MD5; f6b28d7d544807bac9ff119299d4548a.
DR   Ensembl-Gn; ENSMUSG00000030745; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033000; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2598
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="2D6; IL-12 dependent"
FT                   /cell_type="T cell"
FT                   /db_xref="taxon:10090"
FT   CDS             391..1980
FT                   /codon_start=1
FT                   /gene="LR-beta"
FT                   /product="lymphocyte receptor beta"
FT                   /note="novel type 1 cytokine receptor; Il2rb-like receptor"
FT                   /db_xref="GOA:Q9JHX3"
FT                   /db_xref="InterPro:IPR003531"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1890475"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHX3"
FT                   /protein_id="AAF86350.1"
FT                   /translation="MPRGPVAALLLLILHGAWSCLDLTCYTDYLWTITCVLETRSPNPS
FT                   ILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGN
FT                   NSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNL
FT                   RDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVI
FT                   FQTQAGEPEAGWDPHMLLLLAVLIIVLVFMGLKIHLPWRLWKKIWAPVPTPESFFQPLY
FT                   REHSGNFKKWVNTPFTASSIELVPQSSTTTSALHLSLYPAKEKKFPGLPGLEEQLECDG
FT                   MSEPGHWCIIPLAAGQAVSAYSEERDRPYGLVSIDTVTVGDAEGLCVWPCSCEDDGYPA
FT                   MNLDAGRESGPNSEDLLLVTDPAFLSCGCVSGSGLRLGGSPGSLLDRLRLSFAKEGDWT
FT                   ADPTWRTGSPGGGSESEAGSPPGLDMDTFDSGFAGSDCGSPVETDEGPPRSYLRQWVVR
FT                   TPPPVDSGAQSS"
FT   misc_feature    1030..1044
FT                   /gene="LR-beta"
FT                   /note="Region: WSXWS motif"
XX
SQ   Sequence 2598 BP; 591 A; 672 C; 744 G; 591 T; 0 other;
     cagctgtctg cccacttctc ctgtggtgtg cctcacggtc acttgcttgt ctgaccgcaa        60
     gtctgcccat ccctggggca gccaactggc ctcagcccgt gccccaggcg tgccctgtct       120
     ctgtctggct gccccagccc tactgtcttc ctctgtgtag gctctgccca gatgcccggc       180
     tggtcctcag cctcaggact atctcagcag tgactcccct gattctggac ttgcacctga       240
     ctgaactcct gcccacctca aaccttcacc tcccaccacc accactccga gtcccgctgt       300
     gactcccacg cccaggagac cacccaagtg ccccagccta aagaatggct ttctgagaaa       360
     gaccctgaag gagtaggtct gggacacagc atgccccggg gcccagtggc tgccttactc       420
     ctgctgattc tccatggagc ttggagctgc ctggacctca cttgctacac tgactacctc       480
     tggaccatca cctgtgtcct ggagacacgg agccccaacc ccagcatact cagtctcacc       540
     tggcaagatg aatatgagga acttcaggac caagagacct tctgcagcct acacaggtct       600
     ggccacaaca ccacacatat atggtacacg tgccatatgc gcttgtctca attcctgtcc       660
     gatgaagttt tcattgtcaa tgtgacggac cagtctggca acaactccca agagtgtggc       720
     agctttgtcc tggctgagag catcaaacca gctcccccct tgaacgtgac tgtggccttc       780
     tcaggacgct atgatatctc ctgggactca gcttatgacg aaccctccaa ctacgtgctg       840
     aggggcaagc tacaatatga gctgcagtat cggaacctca gagaccccta tgctgtgagg       900
     ccggtgacca agctgatctc agtggactca agaaacgtct ctcttctccc tgaagagttc       960
     cacaaagatt ctagctacca gctgcaggtg cgggcagcgc ctcagccagg cacttcattc      1020
     agggggacct ggagtgagtg gagtgacccc gtcatctttc agacccaggc tggggagccc      1080
     gaggcaggct gggaccctca catgctgctg ctcctggctg tcttgatcat tgtcctggtt      1140
     ttcatgggtc tgaagatcca cctgccttgg aggctatgga aaaagatatg ggcaccagtg      1200
     cccacccctg agagtttctt ccagcccctg tacagggagc acagcgggaa cttcaagaaa      1260
     tgggttaata cccctttcac ggcctccagc atagagttgg tgccacagag ttccacaaca      1320
     acatcagcct tacatctgtc attgtatcca gccaaggaga agaagttccc ggggctgccg      1380
     ggtctggaag agcaactgga gtgtgatgga atgtctgagc ctggtcactg gtgcataatc      1440
     cccttggcag ctggccaagc ggtctcagcc tacagtgagg agagagaccg gccatatggt      1500
     ctggtgtcca ttgacacagt gactgtggga gatgcagagg gcctgtgtgt ctggccctgt      1560
     agctgtgagg atgatggcta tccagccatg aacctggatg ctggccgaga gtctggccct      1620
     aattcagagg atctgctctt ggtcacagac cctgcttttc tgtcttgcgg ctgtgtctca      1680
     ggtagtggtc tcaggcttgg aggctcccca ggcagcctac tggacaggtt gaggctgtca      1740
     tttgcaaagg aaggggactg gacagcagac ccaacctgga gaactgggtc cccaggaggg      1800
     ggctctgaga gtgaagcagg ttccccccct ggtctggaca tggacacatt tgacagtggc      1860
     tttgcaggtt cagactgtgg cagccccgtg gagactgatg aaggaccccc tcgaagctat      1920
     ctccgccagt gggtggtcag gacccctcca cctgtggaca gtggagccca gagcagctag      1980
     catataataa ccagctatag tgagaagagg cctctgagcc tggcatttac agtgtgaaca      2040
     tgtaggggtg tgtgtgtgtg tgtgtgtgtg tgtgtgtgtg tgtgtgtgtg tgtgtgtgtg      2100
     tgtgtgtctt gggttgtgtg ttagcacatc catgttggga tttggtctgt tgctatgtat      2160
     tgtaatgcta aattctctac ccaaagttct aggcctacga gtgaattctc atgtttacaa      2220
     acttgctgtg taaaccttgt tccttaattt aataccattg gttaaataaa attggctgca      2280
     accaattact ggagggatta gaggtagggg gcttttgagt tacctgtttg gagatggaga      2340
     aggagagagg agagaccaag aggagaagga ggaaggagag gagaggagag gagaggagag      2400
     gagaggagag gagaggagag gagaggagag gagaggctgc cgtgagggga gagggaccat      2460
     gagcctgtgg ccaggagaaa cagcaagtat ctggggtaca ctggtgagga ggtggccagg      2520
     ccagcagtta gaagagtaga ttaggggtga cctccagtat ttgtcaaagc caattaaaat      2580
     aacaaaaaaa aaaaaaaa                                                    2598
//


spacer
spacer