spacer

EBI Dbfetch

ID   AF269134; SV 1; linear; mRNA; STD; MUS; 1590 BP.
XX
AC   AF269134;
XX
DT   16-OCT-2000 (Rel. 65, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus novel interleukin receptor (Nilr) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1590
RX   DOI; 10.1073/pnas.200360997.
RX   PUBMED; 11016959.
RA   Ozaki K., Kikly K., Michalovich D., Young P.R., Leonard W.J.;
RT   "Cloning of a type I cytokine receptor most related to the IL-2 receptor
RT   beta chain";
RL   Proc. Natl. Acad. Sci. U.S.A. 97(21):11439-11444(2000).
XX
RN   [2]
RP   1-1590
RA   Ozaki K., Leonard W.J.;
RT   ;
RL   Submitted (18-MAY-2000) to the INSDC.
RL   LMI, NHLBI/NIH, Bldg.10, Rm 7N252, 9000 Rockville Pike, Bethesda, MD 20892,
RL   USA
XX
DR   MD5; b01ad62775d443de741dcc033621e2c7.
DR   Ensembl-Gn; ENSMUSG00000030745; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033000; mus_musculus.
DR   EuropePMC; PMC17218; 11016959.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1590
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="thymus; spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1590
FT                   /codon_start=1
FT                   /gene="Nilr"
FT                   /product="novel interleukin receptor"
FT                   /note="type I cytokine receptor"
FT                   /db_xref="GOA:Q9JHX3"
FT                   /db_xref="InterPro:IPR003531"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1890475"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHX3"
FT                   /protein_id="AAG23420.1"
FT                   /translation="MPRGPVAALLLLILHGAWSCLDLTCYTDYLWTITCVLETRSPNPS
FT                   ILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGN
FT                   NSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNL
FT                   RDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVI
FT                   FQTQAGEPEAGWDPHMLLLLAVLIIVLVFMGLKIHLPWRLWKKIWAPVPTPESFFQPLY
FT                   REHSGNFKKWVNTPFTASSIELVPQSSTTTSALHLSLYPAKEKKFPGLPGLEEQLECDG
FT                   MSEPGHWCIIPLAAGQAVSAYSEERDRPYGLVSIDTVTVGDAEGLCVWPCSCEDDGYPA
FT                   MNLDAGRESGPNSEDLLLVTDPAFLSCGCVSGSGLRLGGSPGSLLDRLRLSFAKEGDWT
FT                   ADPTWRTGSPGGGSESEAGSPPGLDMDTFDSGFAGSDCGSPVETDEGPPRSYLRQWVVR
FT                   TPPPVDSGAQSS"
XX
SQ   Sequence 1590 BP; 347 A; 445 C; 447 G; 351 T; 0 other;
     atgccccggg gcccagtggc tgccttactc ctgctgattc tccatggagc ttggagctgc        60
     ctggacctca cttgctacac tgactacctc tggaccatca cctgtgtcct ggagacacgg       120
     agccccaacc ccagcatact cagtctcacc tggcaagatg aatatgagga acttcaggac       180
     caagagacct tctgcagcct acacaggtct ggccacaaca ccacacatat atggtacacg       240
     tgccatatgc gcttgtctca attcctgtcc gatgaagttt tcattgtcaa tgtgacggac       300
     cagtctggca acaactccca agagtgtggc agctttgtcc tggctgagag catcaaacca       360
     gctcccccct tgaacgtgac tgtggccttc tcaggacgct atgatatctc ctgggactca       420
     gcttatgacg aaccctccaa ctacgtgctg aggggcaagc tacaatatga gctgcagtat       480
     cggaacctca gagaccccta tgctgtgagg ccggtgacca agctgatctc agtggactca       540
     agaaacgtct ctcttctccc tgaagagttc cacaaagatt ctagctacca gctgcaggtg       600
     cgggcagcgc ctcagccagg cacttcattc agggggacct ggagtgagtg gagtgacccc       660
     gtcatctttc agacccaggc tggggagccc gaggcaggct gggaccctca catgctgctg       720
     ctcctggctg tcttgatcat tgtcctggtt ttcatgggtc tgaagatcca cctgccttgg       780
     aggctatgga aaaagatatg ggcaccagtg cccacccctg agagtttctt ccagcccctg       840
     tacagggagc acagcgggaa cttcaagaaa tgggttaata cccctttcac ggcctccagc       900
     atagagttgg tgccacagag ttccacaaca acatcagcct tacatctgtc attgtatcca       960
     gccaaggaga agaagttccc ggggctgccg ggtctggaag agcaactgga gtgtgatgga      1020
     atgtctgagc ctggtcactg gtgcataatc cccttggcag ctggccaagc ggtctcagcc      1080
     tacagtgagg agagagaccg gccatatggt ctggtgtcca ttgacacagt gactgtggga      1140
     gatgcagagg gcctgtgtgt ctggccctgt agctgtgagg atgatggcta tccagccatg      1200
     aacctggatg ctggccgaga gtctggccct aattcagagg atctgctctt ggtcacagac      1260
     cctgcttttc tgtcttgcgg ctgtgtctca ggtagtggtc tcaggcttgg aggctcccca      1320
     ggcagcctac tggacaggtt gaggctgtca tttgcaaagg aaggggactg gacagcagac      1380
     ccaacctgga gaactgggtc cccaggaggg ggctctgaga gtgaagcagg ttccccccct      1440
     ggtctggaca tggacacatt tgacagtggc tttgcaggtt cagactgtgg cagccccgtg      1500
     gagactgatg aaggaccccc tcgaagctat ctccgccagt gggtggtcag gacccctcca      1560
     cctgtggaca gtggagccca gagcagctag                                       1590
//


spacer
spacer