spacer

EBI Dbfetch

ID   AF266467; SV 1; linear; mRNA; STD; MUS; 3512 BP.
XX
AC   AF266467;
XX
DT   08-JUN-2001 (Rel. 68, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus platelet-derived growth factor C (Pdgfc) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3512
RA   Gao Z., Hart C., Piddington C., Sheppard P., Shoemaker K., Gilbertson D.,
RA   West J., O'Hara P.J.;
RT   "Platelet-derived growth factor C (PDGF-C), a novel growth factor that
RT   binds to PDGF alpha receptor";
RL   Unpublished.
XX
RN   [2]
RP   1-3512
RA   Gao Z., Hart C., Piddington C., Sheppard P., Shoemaker K., Gilbertson D.,
RA   West J., O'Hara P.J.;
RT   ;
RL   Submitted (10-MAY-2000) to the INSDC.
RL   Biomolecular Informatics, ZymoGenetics, Inc., 1201 Eastlake Avenue East,
RL   Seattle, WA 98102, USA
XX
DR   MD5; b453b393eaa4608acb8d1f3624a83ffe.
DR   Ensembl-Gn; ENSMUSG00000028019; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029652; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3512
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1022..2059
FT                   /codon_start=1
FT                   /gene="Pdgfc"
FT                   /product="platelet-derived growth factor C"
FT                   /note="PDGF-C/ZVEGF3"
FT                   /db_xref="GOA:Q8CI19"
FT                   /db_xref="InterPro:IPR000072"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:1859631"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CI19"
FT                   /protein_id="AAK58566.1"
FT                   /translation="MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPR
FT                   HERVVTISGNGSIHSPKFPHTYPRNMVLVWRLVAVDENVRIQLTFDERFGLEDPEDDIC
FT                   KYDFVEVEEPSDGSVLGRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSII
FT                   MPQVTETTSPSVLPPSSLSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQL
FT                   LGKAFLYGKKSKVVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCG
FT                   GNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCR
FT                   GNAGG"
XX
SQ   Sequence 3512 BP; 850 A; 920 C; 861 G; 881 T; 0 other;
     ggcgcccagg ggaaaggaag ctgggggccg cctggcggca ttcctcgccg cagtgtgggc        60
     tccgtctgcc gcggggcccg cagtgccccc tgtctgcgcc agcacctgtt ggcccgccag       120
     ctggccgccc gcgccccccg cgccccccgc gcccgcccgg ccgccagccc cgcgccccgc       180
     gcgccgcccg ctgggggaaa gtggagacgg ggaggggaca agagcgatcc tccaggccag       240
     ccaggccttc ccttagccgc ccgtgcttag ccgccacctc tcctcagccc tgcgtcctgc       300
     cctgccttag ggcaggcatc cgagcgctcg cgactccgag ccgcccaagc tctcccggct       360
     tcccgcagca cttcgccggt acccgaggga acttcggtgg ccaccgactg cagcaaggag       420
     gaggctccgc ggtggatccg ggccagtccc gagtcgtccc cgcggcctct ctgcccgccc       480
     gggacccgcg cggcactcgc agggcacggt cccctccccc caggtggggg tggggcgccg       540
     cctgccgccc cgatcagcag ctttgtcatt gatcccaagg tgctcgcctc gctgccgacc       600
     tggcttccag tctggcttgg cgggaccccg agtcctcgcc tgtgtcctgt cccccaaact       660
     gacaggtgct ccctgcgagt cgccacgact catcgccgct cccccgcgtc cccacccctt       720
     ctttcctccc tcgcctaccc ccaccccccg cacttcggca cagctcagga tttgtttaaa       780
     ccttgggaaa ctggttcagg tccaggtttt gctttgatcc ttttcaaaaa ctggagacac       840
     agaagagggc tctaggaaaa acttttggat gggattatgt ggaaactacc ctgcgattct       900
     ctgctgccag agccggccag gcgcttccac cgcagcgcag cctttccccg gctgggctga       960
     gccttggagt cgtcgcttcc ccagtgcccg ccgcgagtga gccctcgccc cagtcagcca      1020
     aatgctcctc ctcggcctcc tcctgctgac atctgccctg gccggccaaa gaacggggac      1080
     tcgggctgag tccaacctga gcagcaagtt gcagctctcc agcgacaagg aacagaacgg      1140
     agtgcaagat ccccggcatg agagagttgt cactatatct ggtaatggga gcatccacag      1200
     cccgaagttt cctcatacat acccaagaaa tatggtgctg gtgtggagat tagttgcagt      1260
     agatgaaaat gtgcggatcc agctgacatt tgatgagaga tttgggctgg aagatccaga      1320
     agacgatata tgcaagtatg attttgtaga agttgaggag cccagtgatg gaagtgtttt      1380
     aggacgctgg tgtggttctg ggactgtgcc aggaaagcag acttctaaag gaaatcatat      1440
     caggataaga tttgtatctg atgagtattt tccatctgaa cccggattct gcatccacta      1500
     cagtattatc atgccacaag tcacagaaac cacgagtcct tcggtgttgc ccccttcatc      1560
     tttgtcattg gacctgctca acaatgctgt gactgccttc agtaccttgg aagagctgat      1620
     tcggtaccta gagccagatc gatggcaggt ggacttggac agcctctaca agccaacatg      1680
     gcagcttttg ggcaaggctt tcctgtatgg gaaaaaaagc aaagtggtga atctgaatct      1740
     cctcaaggaa gaggtaaaac tctacagctg cacaccccgg aacttctcag tgtccatacg      1800
     ggaagagcta aagaggacag ataccatatt ctggccaggt tgtctcctgg tcaagcgctg      1860
     tggaggaaat tgtgcctgtt gtctccataa ttgcaatgaa tgtcagtgtg tcccacgtaa      1920
     agttacaaaa aagtaccatg aggtccttca gttgagacca aaaactggag tcaagggatt      1980
     gcataagtca ctcactgatg tggctctgga acaccacgag gaatgtgact gtgtgtgtag      2040
     aggaaacgca ggagggtaac tgcagccttc gtagcagcac acgtgagcac tggcattctg      2100
     tgtaccccca caagcaacct tcatccccac cagcgttggc cgcagggctc tcagctgctg      2160
     atgctggcta tggtaaagat cttactcgtc tccaaccaaa ttctcagttg tttgcttcaa      2220
     tagccttccc ctgcaggact tcaagtgtct tctaaaagac cagaggcacc aagaggagtc      2280
     aatcacaaag cactgccttc tagaggaagc ccagacaatg gtcttctgac cacagaaaca      2340
     aatgaaatga atgtagatcg ctagcaaact ctggagtgac agcatttctt ttccactgac      2400
     agaatggtgt agcttagttg tcttgatatg ggcaagtgat gtcagcacaa gaaaatggtg      2460
     aaaaacacac acttgattgt gaacaatgca gaaatacttg gatttctcca acctgtttgc      2520
     atagatagac agatgctctg ttttctacaa actcaaagct tttagagagc agctatgtta      2580
     ataggaatta aatgtgccat gctgaaagga aagactgaag ttttcaatgc ttggcaactt      2640
     ctccgcaatt tggaggaaag gtgcggtcat ggtttggaga aagcacacct gcacagagga      2700
     gtggccttcc cttcccttcc ctctgaggtg gcttctgtgt ttcattgtgt atatttttat      2760
     attctccttt tgacattata actgttggct tttctaatct tgttaaatat ttctattttt      2820
     accaaaggta tttaatattc ttttttatga caacctagag caattatttt tagcttgata      2880
     attttttttt ctaaacaaaa ttgttatagc cagaagaaca aagatgattg atataaaaat      2940
     cttgttgctc tgacaaaaac atatgtattt cttccttgta tggtgctaga gcttagcgtc      3000
     atctgcattt gaaaagatgg aatggggaag tttttagaat tggtaggtcg cagggacagt      3060
     ttgataacaa ctgtactatc atcaattccc aattctgttc ttagagctac gaacagaaca      3120
     gagcttgagt aaatatggag ccattgctaa cctacccctt tctatgggaa ataggagtat      3180
     agctcagaga agcacgtccc cagaaacctc gaccatttct aggcacagtg ttctgggcta      3240
     tgctgcgctg tatggacata tcctatttat ttcaatacta gggttttatt acctttaaac      3300
     tctgctccat acacttgtat taatacatgg atatttttat gtacagaagt atatcattta      3360
     aggagttcac ttattatact ctttggcaat tgcaaagaaa atcaacataa tacattgctt      3420
     gtaaatgctt aatctgtgcc caagttttgt ggtgactatt tgaattaaaa tgtattgaat      3480
     catcaaataa aataatctgg ctattttggg ga                                    3512
//


spacer
spacer