spacer

EBI Dbfetch

ID   AF254738; SV 1; linear; genomic DNA; STD; MUS; 927 BP.
XX
AC   AF254738;
XX
DT   18-JUL-2000 (Rel. 64, Created)
DT   25-JUL-2000 (Rel. 64, Last updated, Version 2)
XX
DE   Mus musculus beta 1,3-galactosyltransferase-V (B3gt5) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-927
RX   DOI; 10.1074/jbc.C000263200.
RX   PUBMED; 10837462.
RA   Zhou D., Henion T.R., Jungalwala F.B., Berger E.G., Hennet T.;
RT   "The beta 1,3-galactosyltransferase beta 3GalT-V is a stage-specific
RT   embryonic antigen-3 (SSEA-3) synthase";
RL   J Biol Chem 275(30):22631-22634(2000).
XX
RN   [2]
RP   1-927
RA   Zhou D., Hennet T.;
RT   ;
RL   Submitted (11-APR-2000) to the INSDC.
RL   Physiology, University of Zurich, Winterthurerstrasse 190, Zurich 8057,
RL   Switzerland
XX
DR   MD5; b09a2de8ee85bbce90a7900d05ba53d8.
DR   Ensembl-Gn; ENSMUSG00000074892; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099497; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..927
FT                   /organism="Mus musculus"
FT                   /strain="129/SvJ"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>927
FT                   /gene="B3gt5"
FT                   /product="beta 1,3-galactosyltransferase-V"
FT   CDS             1..927
FT                   /codon_start=1
FT                   /gene="B3gt5"
FT                   /product="beta 1,3-galactosyltransferase-V"
FT                   /db_xref="GOA:Q9JI67"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:2136878"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JI67"
FT                   /protein_id="AAF86241.1"
FT                   /translation="MAHMKTRLVYASILMMGALCLYFSMDSFRELPFVFKKSHGKFLQI
FT                   PDIDCKQKPPFLVLLVTSSHKQLAARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEM
FT                   DATTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGY
FT                   LTELLLKKNKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSD
FT                   VAIQVYNVSESVPFIKLEDVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVCRFQKIVA
FT                   CHFMKPQDLLTYWQALENSKEQDCPAV"
XX
SQ   Sequence 927 BP; 226 A; 241 C; 235 G; 225 T; 0 other;
     atggctcaca tgaagacaag gctagtttac gcctccattc tcatgatggg cgcactctgc        60
     ttgtacttca gcatggattc tttcagagaa ctcccgtttg tttttaagaa aagtcacggg       120
     aagttccttc agattccgga tatagactgc aagcagaagc cgcctttcct ggtgctgctg       180
     gtgacgtcat ctcacaagca gctggccgct cgcatggcca tccgcaagac gtggggtaga       240
     gagacatctg tgcagggcca acaggtgagg accttcttcc ttctggggac ctccgacagc       300
     accgaggaga tggacgccac aaccctggag agcgagcagc accgcgacat tatccagaag       360
     gacttcaagg atgcctactt caacctgacc ctgaagacca tgatgggtat ggaatgggtc       420
     taccactttt gtcctcagac agcttacgtg atgaaaacgg actctgacat gtttgtgaat       480
     gttggctatc tgacggaact gctgctaaag aaaaacaaaa cgaccaggtt cttcacaggc       540
     tacataaagc cccacgactt tcccatccgg cagaagttca acaagtggtt tgtgagtaag       600
     ttcgaatatc cctgggacag gtacccacct ttttgctccg gtactggtta tgtcttttcc       660
     agcgacgtgg cgatccaagt atacaacgtc tcagagagcg ttccgttcat caagctggag       720
     gatgtgtttg ttgggctctg cttggccaag ctaaagatcc ggccggagga gctgcacacc       780
     aaacagacct tcttccctgg cggtttacgc ttttccgtgt gccgctttca gaaaattgtg       840
     gcatgccatt ttatgaagcc ccaggacctg ctcacttact ggcaagcact ggagaactcg       900
     aaagaacagg actgtcctgc tgtctga                                           927
//


spacer
spacer