spacer

EBI Dbfetch

ID   AF254068; SV 1; linear; mRNA; STD; MUS; 1735 BP.
XX
AC   AF254068;
XX
DT   05-NOV-2000 (Rel. 65, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus interleukin 21 receptor (Il21r) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1735
RX   DOI; 10.1038/35040504.
RX   PUBMED; 11081504.
RA   Parrish-Novak J., Dillon S.R., Nelson A., Hammond A., Sprecher C.,
RA   Gross J.A., Johnston J., Madden K., Xu W., West J., Schrader S.,
RA   Burkhead S., Heipel M., Brandt C., Kuijper J.L., Kramer J., Conklin D.,
RA   Presnell S.R., Berry J., Shiota F., Bort S., Hambly K., Mudri S., Clegg C.,
RA   Moore M., Grant F.J., Lofton-Day C., Gilbert T., Rayond F., Ching A.,
RA   Yao L., Smith D., Webster P., Whitmore T., Maurer M., Kaushansky K.,
RA   Holly R.D., Foster D.;
RT   "Interleukin 21 and its receptor are involved in NK cell expansion and
RT   regulation of lymphocyte function";
RL   Nature 408(6808):57-63(2000).
XX
RN   [2]
RP   1-1735
RA   Parrish-Novak J.E., Presnell S.R., Conklin D.C., Hammond A.K.;
RT   ;
RL   Submitted (10-APR-2000) to the INSDC.
RL   Functional Cloning, ZymoGenetics, Inc., 1201 Eastlake Ave. E., Seattle, WA
RL   98102, USA
XX
DR   MD5; 46e06e8d52b3581fb42dd7d59c05f2aa.
DR   Ensembl-Gn; ENSMUSG00000030745; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033000; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1735
FT                   /organism="Mus musculus"
FT                   /strain="C57Bl/6"
FT                   /mol_type="mRNA"
FT                   /cell_type="splenocytes"
FT                   /db_xref="taxon:10090"
FT   CDS             143..1732
FT                   /codon_start=1
FT                   /gene="Il21r"
FT                   /product="interleukin 21 receptor"
FT                   /note="class I cytokine receptor"
FT                   /db_xref="GOA:Q9JHX3"
FT                   /db_xref="InterPro:IPR003531"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1890475"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHX3"
FT                   /protein_id="AAG29347.1"
FT                   /translation="MPRGPVAALLLLILHGAWSCLDLTCYTDYLWTITCVLETRSPNPS
FT                   ILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGN
FT                   NSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNL
FT                   RDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVI
FT                   FQTQAGEPEAGWDPHMLLLLAVLIIVLVFMGLKIHLPWRLWKKIWAPVPTPESFFQPLY
FT                   REHSGNFKKWVNTPFTASSIELVPQSSTTTSALHLSLYPAKEKKFPGLPGLEEQLECDG
FT                   MSEPGHWCIIPLAAGQAVSAYSEERDRPYGLVSIDTVTVGDAEGLCVWPCSCEDDGYPA
FT                   MNLDAGRESGPNSEDLLLVTDPAFLSCGCVSGSGLRLGGSPGSLLDRLRLSFAKEGDWT
FT                   ADPTWRTGSPGGGSESEAGSPPGLDMDTFDSGFAGSDCGSPVETDEGPPRSYLRQWVVR
FT                   TPPPVDSGAQSS"
XX
SQ   Sequence 1735 BP; 384 A; 502 C; 476 G; 373 T; 0 other;
     ctgcccacct caaaccttca cctcccacca ccaccactcc gagtcccgct gtgactccca        60
     cgcccaggag accacccaag tgccccagcc taaagaatgg ctttctgaga aagaccctga       120
     aggagtaggt ctgggacaca gcatgccccg gggcccagtg gctgccttac tcctgctgat       180
     tctccatgga gcttggagct gcctggacct cacttgctac actgactacc tctggaccat       240
     cacctgtgtc ctggagacac ggagccccaa ccccagcata ctcagtctca cctggcaaga       300
     tgaatatgag gaacttcagg accaagagac cttctgcagc ctacacaggt ctggccacaa       360
     caccacacat atatggtaca cgtgccatat gcgcttgtct caattcctgt ccgatgaagt       420
     tttcattgtc aatgtgacgg accagtctgg caacaactcc caagagtgtg gcagctttgt       480
     cctggctgag agcatcaaac cagctccccc cttgaacgtg actgtggcct tctcaggacg       540
     ctatgatatc tcctgggact cagcttatga cgaaccctcc aactacgtgc tgaggggcaa       600
     gctacaatat gagctgcagt atcggaacct cagagacccc tatgctgtga ggccggtgac       660
     caagctgatc tcagtggact caagaaacgt ctctcttctc cctgaagagt tccacaaaga       720
     ttctagctac cagctgcagg tgcgggcagc gcctcagcca ggcacttcat tcagggggac       780
     ctggagtgag tggagtgacc ccgtcatctt tcagacccag gctggggagc ccgaggcagg       840
     ctgggaccct cacatgctgc tgctcctggc tgtcttgatc attgtcctgg ttttcatggg       900
     tctgaagatc cacctgcctt ggaggctatg gaaaaagata tgggcaccag tgcccacccc       960
     tgagagtttc ttccagcccc tgtacaggga gcacagcggg aacttcaaga aatgggttaa      1020
     tacccctttc acggcctcca gcatagagtt ggtgccacag agttccacaa caacatcagc      1080
     cttacatctg tcattgtatc cagccaagga gaagaagttc ccggggctgc cgggtctgga      1140
     agagcaactg gagtgtgatg gaatgtctga gcctggtcac tggtgcataa tccccttggc      1200
     agctggccaa gcggtctcag cctacagtga ggagagagac cggccatatg gtctggtgtc      1260
     cattgacaca gtgactgtgg gagatgcaga gggcctgtgt gtctggccct gtagctgtga      1320
     ggatgatggc tatccagcca tgaacctgga tgctggccga gagtctggcc ctaattcaga      1380
     ggatctgctc ttggtcacag accctgcttt tctgtcttgc ggctgtgtct caggtagtgg      1440
     tctcaggctt ggaggctccc caggcagcct actggacagg ttgaggctgt catttgcaaa      1500
     ggaaggggac tggacagcag acccaacctg gagaactggg tccccaggag ggggctctga      1560
     gagtgaagca ggttcccccc ctggtctgga catggacaca tttgacagtg gctttgcagg      1620
     ttcagactgt ggcagccccg tggagactga tgaaggaccc cctcgaagct atctccgcca      1680
     gtgggtggtc aggacccctc cacctgtgga cagtggagcc cagagcagct agcat           1735
//


spacer
spacer