Dbfetch

ID   AF253540; SV 1; linear; mRNA; STD; MUS; 331 BP.
XX
AC   AF253540;
XX
DT   26-APR-2000 (Rel. 63, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus adenylyl cyclase 3 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-331
RA   Lee K.-W., Han P.-L.;
RT   "Mouse AC3";
RL   Unpublished.
XX
RN   [2]
RP   1-331
RA   Lee K.-W., Han P.-L.;
RT   ;
RL   Submitted (07-APR-2000) to the INSDC.
RL   Neurobiology, Korea Research Institute of Bioscience and Biotechnology,
RL   Eungdong 52, Taejon 305-333, Korea
XX
DR   MD5; d46cedd1d017e35d9b9ad23e707b0b3b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..331
FT                   /organism="Mus musculus"
FT                   /strain="129/SvJae X C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>331
FT                   /codon_start=2
FT                   /product="adenylyl cyclase 3"
FT                   /note="AC3"
FT                   /db_xref="GOA:Q9JK77"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="MGI:MGI:99675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JK77"
FT                   /protein_id="AAF65474.1"
FT                   /translation="ILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQLRIK
FT                   ILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTVLGG
FT                   VLGQKR"
XX
SQ   Sequence 331 BP; 66 A; 92 C; 98 G; 75 T; 0 other;
     catcctgttt gcagatattg tgggctttac ccagctgtcc tctgcttgca gtgcccagga        60
     gctcgtgaag ttactcaacg agctcttcgc ccgctttgac aagctggcag ccaaatacca       120
     ccagctgagg atcaagatcc taggcgactg ttactactgc atctgcggct tgcctgacta       180
     ccgggaggac catgccgtgt gctccatcct tatggggctt gccatggtag aggccatctc       240
     gtacgtgcgg gagaagacca agactggagt ggacatgcgt gtgggagtgc acacaggcac       300
     tgtcctaggc ggtgtcctgg gccagaagcg c                                      331
//