spacer

EBI Dbfetch

ID   AF248636; SV 1; linear; mRNA; STD; MUS; 1511 BP.
XX
AC   AF248636;
XX
DT   24-AUG-2000 (Rel. 64, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus lymphocyte antigen 108 isoform s mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1511
RX   DOI; 10.1007/s002510000252.
RX   PUBMED; 11132158.
RA   Peck S.R., Ruley H.E.;
RT   "Ly108: a new member of the mouse CD2 family of cell surface proteins";
RL   Immunogenetics 52(1-2):63-72(2000).
XX
RN   [2]
RP   1-1511
RA   Peck S.R., Ruley H.E.;
RT   ;
RL   Submitted (21-MAR-2000) to the INSDC.
RL   Department of Microbiology and Immunology, Vanderbilt University School of
RL   Medicine, 1161 21st Ave South / AA4206 Medical Center North, Nashville, TN
RL   37232-2363, USA
XX
DR   MD5; 8e848cb5b8955cad0cb863dd3240ec90.
DR   Ensembl-Gn; ENSMUSG00000015314; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171330; mus_musculus.
DR   EuropePMC; PMC3135348; 21422172.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1511
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /tissue_lib="Stratagene mouse spleen Cat. number 936308"
FT                   /tissue_type="spleen"
FT                   /note="distal arm"
FT                   /db_xref="taxon:10090"
FT   CDS             194..1249
FT                   /codon_start=1
FT                   /product="lymphocyte antigen 108 isoform s"
FT                   /note="Ly108-s"
FT                   /db_xref="GOA:Q9ET39"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015631"
FT                   /db_xref="MGI:MGI:1353620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ET39"
FT                   /protein_id="AAG01738.1"
FT                   /translation="MAVSRAPAPDSACQRMVWLFPLVFCLGSGSEVSQSSSDPQLMNGV
FT                   LGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQ
FT                   SYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQ
FT                   IHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVS
FT                   VSTQSLCKGVLTNPPWNAVWFMTTISIISAVILIFVCWSIHVWKRRGSLPLTSQHPESS
FT                   QSTDGPGSPGNTVYAQVTRPMQEMKIPKPIKNDSMTIYSIVNHSREETVALTGYNQPIT
FT                   LKVNTLINYNS"
FT   polyA_signal    1498..1503
XX
SQ   Sequence 1511 BP; 459 A; 348 C; 331 G; 373 T; 0 other;
     agaagtcttg cctggttaca gaagatggcc cgttcaagtt ccacgttccc tactgctaag        60
     agtcttagct tacaaaagat attcttgtaa gccaagtgtg aagttaatca cgacaaccaa       120
     aggtttgcta acatagagga agagctctca tcaatagggg aacagaaagt ctcagcgaca       180
     agcttatgaa agaatggctg tctcaagggc tccagcaccc gactccgcct gtcagaggat       240
     ggtctggctc tttccacttg tcttctgcct cggctcaggg agtgaagttt cacagagcag       300
     ctcagacccc cagctaatga atggcgttct aggagagtct gcagttcttc ctctaaagct       360
     tcctgcaggg aagatagcca atatcatcat ctggaattat gaatgggaag cgtcacaagt       420
     cactgccctc gttatcaacc taagtaatcc tgaaagtcca caaatcatga acactgatgt       480
     aaagaagaga ctgaacatca cccagtccta ctccctgcaa atcagcaacc ttaccatggc       540
     agacacagga tcatacactg cgcagataac cacaaaggac tctgaagtga tcaccttcaa       600
     atatattctg agggtctttg aacgattggg taacttagaa actaccaact atactctcct       660
     gctagagaat gggacctgcc agatacacct ggcctgtgtt ttgaagaatc aaagtcaaac       720
     tgtctcagtt gagtggcaag ccacaggaaa catctcttta ggaggaccaa atgtcactat       780
     cttttgggac ccgaggaatt ctggtgacca gacttacgtc tgcagagcca agaatgctgt       840
     cagcaatttg tcagtctctg tttcgaccca gagtctctgc aaaggggttc taactaatcc       900
     accctggaat gcagtatggt ttatgactac aatttcaata atcagtgcag tcatactcat       960
     ctttgtgtgc tggagcatac atgtttggaa gagaagaggt tctcttcctt tgactagcca      1020
     acatccagag tcctcccaga gcacagatgg cccaggctct ccagggaaca ctgtgtatgc      1080
     acaagtcact cgtccaatgc aggaaatgaa aatcccaaaa cctatcaaaa atgactccat      1140
     gacaatttac tccatagtta atcattccag agaggaaaca gtggctttaa ccggctataa      1200
     ccaacccatt accctgaagg ttaacacttt aatcaactat aactcctgaa ggaagagcac      1260
     tgcagtgact tgaggaaatt aaacaatgct gtcaccacag ctctggctta gattaatgaa      1320
     gtcagcatct ctggagattg agcgctgcca tttgcattgt tcaaacgctt tctaggtggt      1380
     atggtgagat gccagagggc taagggccat tatagcaggg tagtttgact aggaatacat      1440
     aagatagaaa gcctagaatc gtatcattga aagggacaat ggacctaaga gaagtggaat      1500
     aaaattgtgt c                                                           1511
//


spacer
spacer