spacer

EBI Dbfetch

ID   AF248635; SV 1; linear; mRNA; STD; MUS; 2445 BP.
XX
AC   AF248635;
XX
DT   24-AUG-2000 (Rel. 64, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus lymphocyte antigen 108 isoform l mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2445
RX   DOI; 10.1007/s002510000252.
RX   PUBMED; 11132158.
RA   Peck S.R., Ruley H.E.;
RT   "Ly108: a new member of the mouse CD2 family of cell surface proteins";
RL   Immunogenetics 52(1-2):63-72(2000).
XX
RN   [2]
RP   1-2445
RA   Peck S.R., Ruley H.E.;
RT   ;
RL   Submitted (21-MAR-2000) to the INSDC.
RL   Department of Microbiology and Immunology, Vanderbilt University School of
RL   Medicine, 1161 21st Ave South / AA4206 Medical Center North, Nashville, TN
RL   37232-2363, USA
XX
DR   MD5; 2b4ad7474c0a20a57a662dc3c2c89b0a.
DR   Ensembl-Gn; ENSMUSG00000015314; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171330; mus_musculus.
DR   EuropePMC; PMC3135348; 21422172.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2445
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /tissue_lib="Stratagene mouse spleen Cat. number 936308"
FT                   /tissue_type="spleen"
FT                   /note="distal arm"
FT                   /db_xref="taxon:10090"
FT   CDS             172..1167
FT                   /codon_start=1
FT                   /product="lymphocyte antigen 108 isoform l"
FT                   /note="Ly108-l"
FT                   /db_xref="GOA:Q9ET39"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015631"
FT                   /db_xref="MGI:MGI:1353620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ET39"
FT                   /protein_id="AAG01737.1"
FT                   /translation="MAVSRAPAPDSACQRMVWLFPLVFCLGSGSEVSQSSSDPQLMNGV
FT                   LGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQ
FT                   SYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQ
FT                   IHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVS
FT                   VSTQSLCKGVLTNPPWNAVWFMTTISIISAVILIFVCWSIHVWKRRGSLPLTSQHPESS
FT                   QSTDGPGSPGNTVYAQVTRPMQEMKIPKPIKNDSMTIYSIVNHSREAEYS"
FT   polyA_signal    2425..2430
XX
SQ   Sequence 2445 BP; 704 A; 599 C; 463 G; 679 T; 0 other;
     agatggcccg ttcaagttcc acgttcccta ctgctaagag tcttagctta caaaagatat        60
     tcttgtaagc caagtgtgaa gttaatcacg acaaccaaag gtttgctaac atagaggaag       120
     agctctcatc aataggggaa cagaaagtct cagcgacaag cttatgaaag aatggctgtc       180
     tcaagggctc cagcacccga ctccgcctgt cagaggatgg tctggctctt tccacttgtc       240
     ttctgcctcg gctcagggag tgaagtttca cagagcagct cagaccccca gctaatgaat       300
     ggcgttctag gagagtctgc agttcttcct ctaaagcttc ctgcagggaa gatagccaat       360
     atcatcatct ggaattatga atgggaagcg tcacaagtca ctgccctcgt tatcaaccta       420
     agtaatcctg aaagtccaca aatcatgaac actgatgtaa agaagagact gaacatcacc       480
     cagtcctact ccctgcaaat cagcaacctt accatggcag acacaggatc atacactgcg       540
     cagataacca caaaggactc tgaagtgatc accttcaaat atattctgag ggtctttgaa       600
     cgattgggta acttagaaac taccaactat actctcctgc tagagaatgg gacctgccag       660
     atacacctgg cctgtgtttt gaagaatcaa agtcaaactg tctcagttga gtggcaagcc       720
     acaggaaaca tctctttagg aggaccaaat gtcactatct tttgggaccc gaggaattct       780
     ggtgaccaga cttacgtctg cagagccaag aatgctgtca gcaatttgtc agtctctgtt       840
     tcgacccaga gtctctgcaa aggggttcta actaatccac cctggaatgc agtatggttt       900
     atgactacaa tttcaataat cagtgcagtc atactcatct ttgtgtgctg gagcatacat       960
     gtttggaaga gaagaggttc tcttcctttg actagccaac atccagagtc ctcccagagc      1020
     acagatggcc caggctctcc agggaacact gtgtatgcac aagtcactcg tccaatgcag      1080
     gaaatgaaaa tcccaaaacc tatcaaaaat gactccatga caatttactc catagttaat      1140
     cattccagag aggctgaata ctcttaaaga catcaagttg gcgaaagact ttaaagaaat      1200
     ccagggagaa cacatctact gatcccttgg aagagaacag aaaagaagcg tgctttccaa      1260
     ctggcaatgg gatccggatg cccagggtta tcacttcagc ctggatcctt cctacaagtg      1320
     tcagactctt caggggtagc aagatctgta gtacataacc ccaaaactac attccagtca      1380
     gatccaggac aaatcctgct ttgggtaact catccacacg ctgctttctc tctgacaact      1440
     aaacagtcag agttctgatg gacagattat gatttcgcaa gtaatcactt ctccttctag      1500
     aaggcagcag gatgtgattg gctgtagaga gagcacggtg ttttggttaa atgtgtagta      1560
     tctggcattg gatggaccac actcatgccc tgacaaatca tttacttaga caggccccct      1620
     gggatatttc ctatgttctt ggacctttaa tctcacagcc aataagagga ggatagcgat      1680
     gcattgcttc cattgctcac accaggaatc taagccatcc atgactacag tttatcccca      1740
     aacacttcag actctacctc caatatatat taaacagatc tctctctttt caacttgtag      1800
     accatcatcc tatctccatt tctcccatct ggaacctgag gtactccaat tatctctaaa      1860
     catctcttct aattttgctc ttgtctctgc attacccatg gtctaaaaga caaccagcac      1920
     aatgtcctta gtatagtccc actcttccta ttgactgcct gtacccttgc aaactcctca      1980
     tcacagccag tgtgaaagcc agagttcctg gctcaggatg gtctgccaca tccccagact      2040
     ctgctagttt cactctcccc attctctgtt tgatctctgt gaccttttag ctcctctatc      2100
     agagaagaaa tttctccata gtatagtcac ttacatctgc cccaaagctc ttcttctgcc      2160
     tgttgggttc ctcctgtact ttagacctca acttaaatac atcatcttct ataaaagacc      2220
     ttcccagtgc agtctaccta aagagggatt ccttattagt ctctttaact tccatgttgt      2280
     ttatcacatg atattgaata tttattttta atatctgttt cccttattag aggataaatc      2340
     tgtgggatca gagacaataa ctattttatt gctgtaatca ttaatatgta gaacattgta      2400
     agtgttcaaa caataccttt agtaaataaa tgtatacaag atgga                      2445
//


spacer
spacer