Dbfetch

ID   AF248057; SV 1; linear; mRNA; STD; MUS; 1693 BP.
XX
AC   AF248057;
XX
DT   02-MAY-2000 (Rel. 63, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus sulfated glycoprotein-2 isoform 1 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1693
RA   You K.H., Jeon J.H.;
RT   "Identification of Truncated SGP-2 Lacking a Signal Peptide for Secretion";
RL   Unpublished.
XX
RN   [2]
RP   1-1693
RA   You K.H., Jeon J.H.;
RT   ;
RL   Submitted (22-MAR-2000) to the INSDC.
RL   Department of Biology, Chungnam National University, 220,Gungdong
RL   Yusong-gu, Taejon 305-764, Republic of Korea
XX
DR   MD5; 8094a89c58b554060c7e04fb13ea028f.
DR   Ensembl-Gn; ENSMUSG00000022037; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021488; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021447; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021423; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021453; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021230; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021892; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020747; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021197; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021320; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021299; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021395; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021328; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021915; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020491; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020800; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022616; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0039895; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0039865; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0039822; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0039869; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0039605; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0040343; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0039610; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0039523; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0039667; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0039634; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0039758; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0039628; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0040376; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0039220; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0038997; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1693
FT                   /organism="Mus musculus"
FT                   /strain="Balb/c"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /tissue_type="uterus"
FT                   /db_xref="taxon:10090"
FT   CDS             117..1463
FT                   /codon_start=1
FT                   /product="sulfated glycoprotein-2 isoform 1"
FT                   /note="SGP-2"
FT                   /db_xref="GOA:Q549A5"
FT                   /db_xref="InterPro:IPR000753"
FT                   /db_xref="InterPro:IPR016014"
FT                   /db_xref="InterPro:IPR016015"
FT                   /db_xref="InterPro:IPR016016"
FT                   /db_xref="MGI:MGI:88423"
FT                   /db_xref="UniProtKB/TrEMBL:Q549A5"
FT                   /protein_id="AAF67184.1"
FT                   /translation="MKILLLCVALLLIWDNGMVLGEQEVSDNELQELSTQGSRYINKEI
FT                   QNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNET
FT                   MMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLE
FT                   SDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKS
FT                   RLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDR
FT                   TVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQY
FT                   KELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPS
FT                   RVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAE"
XX
SQ   Sequence 1693 BP; 421 A; 496 C; 435 G; 341 T; 0 other;
     cggtctaatc ctcttagttc ccatccaacc accaagtcat cacctccccc gtcaccagga        60
     ggagcgcact ggagccaagc cgcagaccgg actccagatt ccaaggaggc cacgccatga       120
     agattctcct gctgtgcgtg gcactgctgc tgatctggga caatggcatg gtcctgggag       180
     agcaggaggt ctctgacaat gagctccaag aactgtccac tcaagggagt aggtatatta       240
     ataaggagat tcagaacgcc gtccagggag tgaagcacat aaaaactctc atagaaaaaa       300
     ccaacgcaga gcgcaagtcc ttgctcaaca gtttagagga agccaagaag aagaaagagg       360
     atgctctgga ggacactagg gattctgaaa tgaagctgaa ggcattcccg gaagtgtgta       420
     acgagaccat gatggccctc tgggaggagt gcaagccctg cctgaagcat acctgcatga       480
     agttctatgc acgtgtctgc aggagcggct cagggctggt cggccagcag ctagaggagt       540
     ttctaaacca gagctcaccc ttctacttct ggatgaacgg cgaccgcatc gactccctgc       600
     tggagagtga ccggcagcag agccaagtcc tggatgccat gcaggacagc tttgctcggg       660
     catctggcat catagacacg ctctttcagg accggttctt cgcccgtgag cttcatgacc       720
     cccactactt ctcccccatc ggcttcccac acaagaggcc tcatttctta tatcccaagt       780
     cccgcttggt ccgcagcctc atgtctccct cccactatgg gcctccgagc ttccacaaca       840
     tgttccagcc tttctttgag atgatccacc aggctcaaca ggccatggat gtccagctcc       900
     acagcccagc cttccagttc ccagacgtgg atttcttaag agaaggtgaa gatgaccgca       960
     ctgtgtgcaa ggagatccgc cgcaactcca caggatgcct gaagatgaag ggccagtgtg      1020
     aaaagtgcca ggagatcttg tctgtggact gttcaaccaa caatcctgcc caggctaacc      1080
     tgcgccagga gctgaacgac tcgctccagg tggccgagag gctgacagag cagtacaagg      1140
     agctgctgca gtccttccag tcgaagatgc tcaacacctc atccctgctg gagcagctga      1200
     acgaccagtt caactgggtg tcccagctgg ctaacctcac acagggcgaa gacaagtact      1260
     accttcgggt ctccaccgtg accacccatt cctctgactc agaggtcccc tcccgtgtca      1320
     ctgaggtggt ggtgaagctg tttgactctg accccatcac agtggtgtta ccagaagaag      1380
     tctctaagga taaccctaag tttatggaca cagtggcgga gaaggcgcta caggaatacc      1440
     gcaggaaaag ccgtgcggaa tgagatagaa gcatcacctt cctatatgta ggagtgtctg      1500
     ggagggaatc tcccagctcc ccgaggtggc tgcagacccc tagagaactc cacatgtctc      1560
     caggcgagta ggcctcaccc aagcagcctg cccttcctct ggattctgta cactaatgcc      1620
     tgcacttgct gctctcggga agaactgatt cccccacgca actaatccaa taaaagccgc      1680
     cttgcgataa ccg                                                         1693
//