Dbfetch

ID   AF247533; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF247533;
XX
DT   16-AUG-2000 (Rel. 64, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen HLA-DRB1 (HLA-DRB1) gene, HLA-DRB1*GDES
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Greville W.D., Chapman G., Kennedy A., Le T., Trejaut J., Dunckley H.;
RT   "HLA-DRB1 allele detected by PCR-RFLP";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Greville W.D., Chapman G., Kennedy A., Le T., Trejaut J., Dunckley H.;
RT   ;
RL   Submitted (20-MAR-2000) to the INSDC.
RL   Tissue Typing Services, Australian Red Cross Blood Service, 153 Clarence
RL   Street, Sydney, NSW 2000, Australia
XX
DR   MD5; 349b784e9ba70bcd888416e51cda7854.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen HLA-DRB1"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:44"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAF99607.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 56 A; 65 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//