spacer

EBI Dbfetch

ID   AF240694; SV 1; linear; mRNA; STD; MUS; 2560 BP.
XX
AC   AF240694;
XX
DT   27-APR-2001 (Rel. 67, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus organic anion transporting polypeptide 3 (Slc21a7) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2560
RX   PUBMED; 11093941.
RA   Walters H.C., Craddock A.L., Fusegawa H., Willingham M.C., Dawson P.A.;
RT   "Expression, transport properties, and chromosomal location of organic
RT   anion transporter subtype 3";
RL   Am. J. Physiol. Gastrointest. Liver Physiol. 279(6):G1188-G1200(2000).
XX
RN   [2]
RP   1-2560
RA   Walters H.C., Craddock A.L., Fusegawa H., Dawson P.A.;
RT   ;
RL   Submitted (01-MAR-2000) to the INSDC.
RL   Internal Medicine/GI, Wake Forest University School of Medicine, Medical
RL   Center Blvd., Winston-Salem, NC 27157, USA
XX
DR   MD5; bed5907db14244db16552b70fb97100c.
DR   Ensembl-Gn; ENSMUSG00000063975; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081380; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111825; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2560
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /map="between D6Mit291 and D6Mit58"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             95..2107
FT                   /codon_start=1
FT                   /gene="Slc21a7"
FT                   /product="organic anion transporting polypeptide 3"
FT                   /note="Oatp3; mediates transport of organic compounds"
FT                   /db_xref="GOA:Q91YY5"
FT                   /db_xref="InterPro:IPR002350"
FT                   /db_xref="InterPro:IPR004156"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1351865"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91YY5"
FT                   /protein_id="AAK39416.1"
FT                   /translation="MGETEKRIATHGVRCFSKIKMFLLALTCAYVSKSLSGIYMNSMLT
FT                   QIERQFDIPTSIVGLINGSFEIGNLLLIILVSYFGTKLHRPIMIGIGCVIMGLGCFLMS
FT                   LPHFLMGRYEYETTISPTSNLSSNSFLCMENRTQTLKPTQDPAECVKEMKSLMWIYVLV
FT                   GNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGILESGKMIGPIVGLLLGSFCARIYV
FT                   DTGSVNTDDLTITPTDTRWVGAWWIGFLVCAGVNILTSIPFFFFPKTLPKEGLQDNVDR
FT                   TENDKEEKHREKAKEENRGITKDFLPFMKSLSCNPIYMLLILTSVLQINAFINMFTFLP
FT                   KYLEQQYGKSTSEVVLLIGVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEY
FT                   LLSYFHFMISCDNFQVAGLTTSYEGVQHPLYVENKVLADCNTRCSCLTNTWDPVCGDNG
FT                   LSYMSACLAGCEKSVGMGTHMVFQNCSCIQSSGNSSAVLGLCKKGPECANKLQYFLIMS
FT                   VIGSFIYSITAIPGYMVLLRCIKSEEKSLGIGLHAFCTRIFAGIPAPIYFGALIDRTCL
FT                   HWGTLKCGEPGACRMYNINNFRRIYLVLPAALRGSSYLPAFFILILMRKFQLPGEMYSS
FT                   ETELADMKLTVKKSECTDVHRIPKVENDGELKTKL"
XX
SQ   Sequence 2560 BP; 770 A; 532 C; 547 G; 711 T; 0 other;
     gacaccagca gcaaccgtca atgggattgc tgaggagtgc tcagtggtaa gactgtttaa        60
     agaatagtca tttggagaca atcagaagaa caacatggga gaaacagaga aaaggattgc       120
     aacccatggg gtcagatgct tttctaagat caagatgttt ctgttggcat taacatgtgc       180
     atatgtatcc aaatcactct caggaattta tatgaattcc atgcttacac aaatagagag       240
     acaattcgat atccccacat ctatagttgg acttatcaat gggagctttg agattggaaa       300
     tcttttgttg attatactcg tgagttactt tggaacaaaa ttgcacagac ctatcatgat       360
     tggtattgga tgtgtgatta tgggcctagg gtgtttctta atgtccttac ctcatttcct       420
     catgggccga tatgaatatg aaacaacgat ttcacctaca agcaacttgt cctcaaacag       480
     cttcttgtgt atggaaaaca gaacacagac cttaaagcca acgcaagacc ctgcagagtg       540
     tgtgaaagaa atgaaatcat taatgtggat atatgtactg gtaggaaaca tcatacgtgg       600
     aattggtgaa actcccatca tgcccttggg tatttcctac atagaagatt ttgccaaatc       660
     tgaaaactct cctttatata ttgggatttt agaatcagga aagatgattg gcccaattgt       720
     tggacttttg ttgggatcct tctgtgcaag aatttatgta gacacagggt ctgtgaatac       780
     agatgacctg accataactc ccactgatac acgctgggtc ggtgcttggt ggattggctt       840
     tttggtctgt gcaggagtga atatcctgac cagcatcccc tttttcttct ttccaaaaac       900
     actcccaaag gaaggattac aggataatgt ggatagaact gaaaatgaca aagaggagaa       960
     gcacagagaa aaagccaagg aggaaaaccg aggaatcact aaagatttcc tgccattcat      1020
     gaagagcctc tcctgcaatc ctatttacat gcttctcatc ctgacaagtg tgctccagat      1080
     aaacgcattt atcaatatgt ttaccttctt gcccaaatac ctggagcagc agtatggaaa      1140
     atccacttca gaggtcgtcc tcctcatagg tgtttgtaac ttacctccaa tctgcattgg      1200
     atatttactt attggcttta ttatgaagaa gttcaggatt actgtcaaga aggctgcata      1260
     catggcattc tgcctatccc tgtttgagta ccttctgtct tactttcact ttatgataag      1320
     ctgtgataat ttccaagttg ctggcttaac tacctcttat gaaggagttc agcaccctct      1380
     atatgtggag aacaaggtcc ttgctgactg caacacaagg tgtagctgct taacaaacac      1440
     atgggatcca gtgtgtggag acaatggcct atcatacatg tcagcctgcc tcgcgggctg      1500
     tgagaagtct gttggaatgg gaacccacat ggtgtttcaa aattgcagct gcattcagtc      1560
     atcaggaaac tcatctgcag tcctggggct gtgtaaaaaa ggccctgagt gtgctaacaa      1620
     gctgcagtac tttttaatca tgtcggtaat tggcagtttc atctattcga tcacagccat      1680
     acctgggtac atggttcttc tgaggtgtat caagtctgaa gagaagtccc ttggaattgg      1740
     attacacgca ttttgcacaa gaatattcgc tggcatccct gcacccattt actttggagc      1800
     tttgatagac agaacctgct tacattgggg aactctgaaa tgtggtgagc caggagcctg      1860
     taggatgtac aatataaata acttcaggcg catttatcta gtgttgcctg cagcactaag      1920
     aggatcaagc tatctccctg cattcttcat tctgatactt atgaggaaat tccagctccc      1980
     tggggaaatg tactcttctg aaactgaact tgcagacatg aagctcacag tgaagaaaag      2040
     cgagtgcaca gatgtgcaca gaattcctaa ggtcgagaat gatggagaac tgaaaactaa      2100
     gctgtaatga atcttctcct ggcctatgca aggccctgaa cagaatgcac attgcacttc      2160
     ctttgaatca tgagaggtac gagaggaact cttttcctaa aataaatcag ggctggactc      2220
     agtgtaagat attctcaaaa gtcactgtct catcctcagg aggcctctgg tgctcactca      2280
     ttctagtcac atatcccaga gccagtgcta ctttcaaaat catcttagag taaaaccttt      2340
     gaagaggggc cacctaaatg tcgcaatgga aaggcgtgct ttctaccaag gctgacaagt      2400
     tgtgtttgat cattgggacc aacatggcag aaggacagaa ccaaccacgc tttcaggttg      2460
     tccttttctc tttactccca cactgtggtg tgcatatccc accccaaaca aacaaacaaa      2520
     taaaaaaatt tagaaactaa aaaaaaaaaa aaaaaaaaaa                            2560
//


spacer
spacer