Dbfetch

ID   AF240469; SV 1; linear; mRNA; STD; MUS; 2250 BP.
XX
AC   AF240469;
XX
DT   11-SEP-2000 (Rel. 65, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus nicastrin mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2250
RX   DOI; 10.1038/35024009.
RX   PUBMED; 10993067.
RA   Yu G., Nishimura M., Arawaka S., Levitan D., Zhang L., Tandon A.,
RA   Song Y.-Q., Rogaeva E., Chen F., Kawarai T., Supala A., Levesque L., Yu H.,
RA   Yang D.S., Holmes E., Milman P., Liang Y., Zhang D.M., Xu D.H., Sato C.,
RA   Rogaev E., Smith M., Janus C., Zhang Y., Aebersold R., Farrer L., Sorbi S.,
RA   Bruni A., Fraser P.E., St George-Hyslop P.H.;
RT   "Nicastrin modulates presenilin-mediated notch/glp-1 signal transduction
RT   and betaAPP processing";
RL   Nature 407(6800):48-54(2000).
XX
RN   [2]
RP   1-2250
RA   Yu G., Nishimura M., Arawaka S., Levitan D., Zhang L., Tandon A.,
RA   Song Y.-Q., Rogaeva E., Kawarai T., Supala A., Aebersold R., Sorbi S.,
RA   Bruni A., Fraser P.E., St George-Hyslop P.H.;
RT   ;
RL   Submitted (02-MAR-2000) to the INSDC.
RL   Dept. of Medicine, Centre for Research in Neurodegenerative Diseases,
RL   University of Toronto and University Health Network, Rm. 118, Tanz
RL   Neuroscience Bldg., 6 Queen's Park Crescent West, Toronto, Ontario M5S 3H2,
RL   Canada
XX
DR   MD5; a32efe92b08c7468989513fe82fd14d8.
DR   Ensembl-Gn; ENSMUSG00000003458; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016776; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016755; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016721; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016716; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016540; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017178; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016120; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016514; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016621; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016618; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016692; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016645; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017214; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015906; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016182; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003550; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0023537; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0023500; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0023470; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0023479; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0023283; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0023989; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0022828; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0023230; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0023348; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0023362; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0023455; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0023326; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0024028; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0022552; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0022846; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2250
FT                   /organism="Mus musculus"
FT                   /map="near looptail (Lp) locus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             18..2144
FT                   /codon_start=1
FT                   /product="nicastrin"
FT                   /function="modulates beta-APP processing and Notch/Glp1
FT                   signal transduction"
FT                   /note="type 1 transmembrane protein; similar to Homo
FT                   sapiens and Drosophila melanogaster nicastrin encoded by
FT                   GenBank Accession Numbers AF240468 and AF240470; interacts
FT                   with presenilin proteins PS1, PS2, S182, and E5-1"
FT                   /db_xref="GOA:P57716"
FT                   /db_xref="InterPro:IPR008710"
FT                   /db_xref="MGI:MGI:1891700"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57716"
FT                   /protein_id="AAG11413.1"
FT                   /translation="MATTRGGSGPDPGSRGLLLLSFSVVLAGLCGGNSVERKIYIPLNK
FT                   TAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLKWVLTDGPNPPYMVLLEGKLFTR
FT                   DVMEKLKGTTSRIAGLAVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCKKTLW
FT                   NELGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLGQNGSAPSFPLCAMQLFSHMHA
FT                   VISTATCMRRSFIQSTFSINPEIVCDPLSDYNVWSMLKPINTSVGLEPDVRVVVAATRL
FT                   DSRSFFWNVAPGAESAVASFVTQLAAAEALHKAPDVTTLSRNVMFVFFQGETFDYIGSS
FT                   RMVYDMENGKFPVRLENIDSFVELGQVALRTSLDLWMHTDPMSQKNESVKNQVEDLLAT
FT                   LEKSGAGVPEVVLRRLAQSQALPPSSLQRFLRARNISGVVLADHSGSFHNRYYQSIYDT
FT                   AENINVTYPEWQSPEEDLNFVTDTAKALANVATVLARALYELAGGTNFSSSIQADPQTV
FT                   TRLLYGFLVKANNSWFQSILKHDLRSYLDDRPLQHYIAVSSPTNTTYVVQYALANLTGK
FT                   ATNLTREQCQDPSKVPNESKDLYEYSWVQGPWNSNRTERLPQCVRSTVRLARALSPAFE
FT                   LSQWSSTEYSTWAESRWKDIQARIFLIASKKLEFITLIVGFSILIFSLIVTYCINAKAD
FT                   VLFVAPREPGAVSY"
XX
SQ   Sequence 2250 BP; 535 A; 612 C; 563 G; 539 T; 1 other;
     cccagcggag aggcaacatg gctacgacta ggggcggctc tgggcctgac ccaggaagtc        60
     ggggtcttct tcttctgtct ttttccgtgg tactggcagg attgtgtggg ggaaactcag       120
     tggagaggaa aatctacatt cccttaaata aaacagctcc ttgtgtccgc ctgctcaacg       180
     ccactcatca gattggctgc cagtcttcaa ttagtgggga tacaggggtt atccacgtag       240
     tggagaaaga agaagacctg aagtgggtgt tgaccgatgg ccccaacccc ccttacatgg       300
     ttctgctgga gggcaagctc ttcaccagag atgtaatgga gaagctgaag ggaacaacca       360
     gtagaatcgc tggtcttgcc gtgactctag ccaagcccaa ctcaacttca agcttctctc       420
     ctagtgtgca gtgcccaaat gatgggtttg gtatttactc caactcctac gggccagagt       480
     ttgctcactg caagaaaaca ctgtggaatg aactgggcaa cggcttggct tatgaagact       540
     ttagtttccc catctttctt cttgaagatg agaacgaaac caaggtcatc aagcagtgct       600
     atcaagatca caacctgggt cagaatggct ctgcaccaag cttcccattg tgtgctatgc       660
     agctcttctc acacatgcac gccgtcatca gcactgccac ctgcatgcgg cgcagcttca       720
     tccagagcac cttcagcatc aacccagaaa tcgtctgtga ccccttatct gactacaacg       780
     tatggagcat gcttaagcct ataaatacat ctgtgggact agaacctgac gtcagggttg       840
     tggttgcggc cacacggctg gatagccggt cctttttctg gaatgtggcc ccaggggctg       900
     aaagtgctgt agcctccttt gtcactcagc tggctgcagc tgaagctttg cacaaggcac       960
     ctgatgtgac cactctatcc cgaaatgtga tgtttgtctt cttccagggg gaaacttttg      1020
     actacattgg cagctcacgg atggtctatg atatggagaa cggcaagttt cccgtgcggc      1080
     tcgagaacat cgactccttc gtggagctgg gacaggtggc cctaagaact tcactagatc      1140
     tctggatgca cacagatccc atgtctcaga aaaatgagtc tgtgaaaaac caggtggagg      1200
     atcttctggc cactctggag aagagcggtg ctggtgtccc tgaagttgtc ctgaggagac      1260
     tggcccagtc ccaggccctt ccaccttcat ctctacaacg atttcttcgg gctcgaaaca      1320
     tctctggcgt ggtcctggct gaccactctg gctccttcca caatcggtat taccagagca      1380
     tttatgacac ggctgagaac attaatgtga cctatcctga gtggcagagc ccagaagagg      1440
     acctcaactt tgtgacagac actgccaagg cactggcgaa tgtggccaca gtgctggcgc      1500
     gtgcactgta tgagcttgca ggaggaacca acttcagcag ctccatccag gctgatcccc      1560
     agacagttac acgtctgctc tatgggttcc tggttaaagc taacaactca tggtttcagt      1620
     cgatcctgaa acatgaccta aggtcctatt tggatgacag gcctcttcaa cactacatcg      1680
     ccgtctccag ccctaccaac acgacttacg ttgtgcagta cgccttggca aacctgactg      1740
     gcaaggcgac caacctcacc cgagagcagt gccaggatcc aagtaaagtc ccaaatgaga      1800
     gcaaggattt atatgaatac tcgtgggtac aaggcccttg gaattccaac aggacagaga      1860
     ggctcccaca gtgtgtgcgc tccacagtgc gactggccag ggccttgtcc cctgcctttg      1920
     aactgagtca gtggagctcc acagaatact ctacgtgggc ggagagccgc tggaaagaca      1980
     tccaagctcg gatattccta attgccagca aaaagcttga gttcatcacg ctgatcgtgg      2040
     gcttcagcat ccttatcttc tctctcatcg tcacctactg catcaatgcc aaagccgacg      2100
     tccttttygt tgctccccga gagccaggag ctgtgtctta ctgaagagga ctctagctct      2160
     ccctgcctgc tctgaacttt acttcccaga ccaggtgtcc ggctgggaac aaaccactaa      2220
     tttgtcactg gactgtctct gggcctgctt                                       2250
//