Dbfetch

ID   AF231120; SV 1; linear; mRNA; STD; MUS; 3304 BP.
XX
AC   AF231120;
XX
DT   20-MAR-2000 (Rel. 63, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus iron-regulated transporter IREG1 (Ireg1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3304
RX   DOI; 10.1016/S1097-2765(00)80425-6.
RX   PUBMED; 10882071.
RA   McKie A.T., Marciani P., Rolfs A., Brennan K., Wehr K., Barrow D.,
RA   Miret S., Bomford A., Peters T.J., Farzaneh F., Hediger M.A., Hentze M.W.,
RA   Simpson R.J.;
RT   "A novel duodenal iron-regulated transporter, IREG1, implicated in the
RT   basolateral transfer of iron to the circulation";
RL   Mol. Cell 5(2):299-309(2000).
XX
RN   [2]
RP   1-3304
RA   McKie A.T.;
RT   ;
RL   Submitted (02-FEB-2000) to the INSDC.
RL   Molecular Medicine, King's College London, Guy's, King's and St. Thomas'
RL   Medical School, Rayne Institute 123 Coldharbour Lane, London SE5 9NU, UK
XX
DR   MD5; 75b4c729787d55483cdd0a9791412848.
DR   Ensembl-Gn; ENSMUSG00000025993; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0015996; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0015980; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0015935; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015934; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015767; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016387; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015349; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0015739; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0015840; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0015842; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0015910; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015862; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016434; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015133; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015410; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000027137; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019694; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0019671; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0019628; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019620; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019449; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020119; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0018956; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0019403; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0019517; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0019523; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0019605; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019493; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020173; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018713; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019044; mus_musculus_wsbeij.
DR   EuropePMC; PMC1895407; 16239432.
DR   EuropePMC; PMC3822789; 20015204.
DR   RFAM; RF02253; IRE_II.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3304
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   misc_feature    69..103
FT                   /gene="Ireg1"
FT                   /note="iron responsive element IRE"
FT   CDS             271..1983
FT                   /codon_start=1
FT                   /gene="Ireg1"
FT                   /product="iron-regulated transporter IREG1"
FT                   /note="basolateral membrane protein involved in iron
FT                   transport from the intestine to the circulation; highly
FT                   expressed in duodenal mucosa and placenta"
FT                   /db_xref="GOA:Q9JHI9"
FT                   /db_xref="InterPro:IPR009716"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1315204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHI9"
FT                   /protein_id="AAF44329.1"
FT                   /translation="MTKARDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFA
FT                   VSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVI
FT                   LCGIILMMVFLHKNELLTMYHGWVLTVCYILIITIANIANLASTATAITIQRDWIVVVA
FT                   GENRSRLADMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFL
FT                   LWKVYQKTPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQE
FT                   PTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGS
FT                   ILSILMGASAITGIMGTVAFTWLRXKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLD
FT                   LSVSPFEDIRSRFVNVEPVSPTTKIPETVFTTEMHMSNMSNVHEMSTKPIPIVSVSLLF
FT                   AGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPE
FT                   AFGLLVLISVSFVAMGHLMYFRFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV"
XX
SQ   Sequence 3304 BP; 874 A; 694 C; 724 G; 999 T; 13 other;
     ggtggatcct ccaacccgct cccataaggc tttggctttc caacttcagc tacagtgtta        60
     gctaagtttg gaaagaagac aaaaagaaga ccccgtgaca gctttgctgt tgttgtttgc       120
     cttagttgtc ctttggggtc tttcggcata aggctgttgt gcttatagtg gtgctatctt       180
     cggttcctct cactcctgtg aacaagctcc cgggcaagag cagctaaagc taccagcatc       240
     agaacaaaca cggggagaac gcctggtgtc atgaccaagg caagagatca aacccatcag       300
     gaaggatgct gtggatcctt agcaaactac ctgacctcag caaaattcct cctctacctt       360
     ggccactctc tctccacttg gggggatcgg atgtggcact ttgcagtgtc tgtgtttctg       420
     gtggaactct atggaaacag ccttctcttg acagctgtct atggactggt ggtggcaggc       480
     tctgttctgg tcctgggagc catcattggt gactgggtgg ataagaatgc cagacttaaa       540
     gtggcccaga cgtcactagt ggttcagaat gtgtccgtca tcctctgcgg aatcatcctg       600
     atgatggttt tcctacacaa gaatgagctc ctgaccatgt accatggatg ggtccttact       660
     gtctgctaca tcctgatcat cactattgca aacattgcaa atttggccag tactgccact       720
     gcgatcacaa tccaaaggga ctggattgtt gttgtggcag gagaaaacag gagcagatta       780
     gcagacatga atgctaccat tagaaggatt gaccagctaa ccaacatcct ggcccccatg       840
     gctgtcggcc agattatgac atttggttct ccagtcattg gctgtggttt tatttccggt       900
     tggaatttgg tgtccatgtg tgtggagtac ttcttgctct ggaaggttta ccagaagacc       960
     cctgctctgg ctgtaaaagc tgctctcaag gtagaggagt cagaactgaa gcagctgacc      1020
     tcacctaaag atactgagcc aaaacctttg gagggaactc atctaatggg tgagaaagac      1080
     tccaacatcc gtgaacttga atgtgaacaa gagcccacct gtgcctccca gatggcagag      1140
     cccttccgca ctttccgaga tggatgggtc tcctactata accagccagt gtttctggct      1200
     ggcatgggcc tggctttcct ctatatgaca gtcctgggct ttgactgtat cactacaggg      1260
     tacgcctaca ctcaggggct gagtggatcc atccttagta ttttgatggg agcatcagca      1320
     ataactggaa taatgggaac tgtggccttc acctggctac gtcraaaatg tggccttgtt      1380
     cggactggtc tattctcagg actagcccag ctttcctgtt taatcttgtg tgtgatctcc      1440
     gtattcatgc ctggaagccc cttggacctg tctgtttctc catttgaaga tatccgttct      1500
     aggtttgtga atgtggagcc agtgtcccca actaccaaaa tacctgagac cgtctttaca      1560
     acagaaatgc atatgtccaa catgtctaat gtccatgaga tgagtactaa acccatcccc      1620
     atagtctctg tcagcctgct gtttgcagga gtcattgctg ctagaatcgg tctttggtcc      1680
     tttgatttga cggtgacaca gttgctgcaa gaaaatgtaa ttgaatctga aagaggcatt      1740
     atcaatggtg tgcagaactc catgaactac cttcttgacc ttctgcattt catcatggtc      1800
     atcttggccc caaatcctga agcttttggc ttgctggtat tgatttcagt ctcctttgtg      1860
     gcaatgggac atcttatgta tttccgattt gcccagaaga ctctgggcaa ccagattttt      1920
     gtttgtggtc ctgatgaaaa agaagttaca gatgaaaatc aaccgaatac atctgttgta      1980
     taaaaatagt ttagctgtgg cccctgttac tagattgtgg agagcatgtg tgcttatttt      2040
     gtactgcaga atcccaataa atgcctgcat ttctctctgg ttttaccacc tctgtgcctt      2100
     aagggctagg ascactaact aaccatcgcc agcaaagatg gttatttctc cttacatgta      2160
     aacatgggaa aataggaaga gggagaggca gtcagcgtgt gtatagaaag ggcttaatgg      2220
     taaaatgaac ttcccttact cttataagta tattaaattt tgaagagtgg ttgtcaggtg      2280
     agtaaaatta ttccttagca gatatttatt atctactaga ataataaatc aattcaccct      2340
     aaaactcact cttgtaaaag tttgccccac ttcctttttt aagatcagtg atatttttbt      2400
     cagttacatt acagaaacaa gtttttcctc catgtatgaa ggttatagtt agataatgag      2460
     tgttatcctt attaatccca ttgaacttaa ggaawttwtt gwatgtggag gatgaaatgt      2520
     gtaactagac ttgtccaaaa ggttcatgga ataacttttg cattttgacc atcagaaagg      2580
     gcraaatatt acagtaatgt gtgtatggtg gctcttcata aaatgactct caaaatctgc      2640
     agaaagaagr aaagttgtag gtttctagtg tggtacagaa ggacttaagg cttgttatta      2700
     gtgtgattgt agaaactgga agctaagggt gaggacctca tgtaaccaga gtcactgtca      2760
     tcagccatca ctayctatct tggtaaatga gagagctgac ctggcacctt acaggcagaa      2820
     aagcggccca cactaagaaa ggactgcaaa tcagtgartc tgtatagaac attttacctt      2880
     cactgacttg ggccgatgtg tttgtcatct ctgtgttttt ctagagcaac aatagtcaca      2940
     aaagttcccc tttcaatatc cctgagaaga ataaagaaaa aactgtttgt aaatattttt      3000
     ttaaaactgt tctgcaagtc tttttgtaac atgcagtacc aacatgggac attgccttaa      3060
     cttttgatgc actttcatgg agactgactg ccatgcattg ctgtgagcac tttctttgtc      3120
     gttcagttta atcttttcct tcacctttat tacagtatga cataatgatt tactatgttg      3180
     tcaaagcttc ataaaatatt tctatataaa atgtttgtag aatcttcann ngcctttact      3240
     gagttgtgtt ctcccaatta ttgttactta tttcaaaatt agcatataaa aagtgtttga      3300
     tatc                                                                   3304
//