spacer

EBI Dbfetch

ID   AF230803; SV 1; linear; mRNA; STD; MUS; 2869 BP.
XX
AC   AF230803;
XX
DT   06-NOV-2000 (Rel. 65, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus transient receptor potential channel 2-beta mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2869
RX   DOI; 10.1042/0264-6021:3510115.
RX   PUBMED; 10998353.
RA   Hofmann T., Schaefer M., Schultz G., Gudermann T.;
RT   "Cloning, expression and subcellular localization of two novel splice
RT   variants of mouse transient receptor potential channel 2";
RL   Biochem. J. 351(Pt 1):115-122(2000).
XX
RN   [2]
RP   1-2869
RA   Hofmann T., Schaefer M., Schultz G., Gudermann T.;
RT   ;
RL   Submitted (02-FEB-2000) to the INSDC.
RL   Institut fuer Pharmakologie, Freie Universitaet Berlin, Thielallee 67-73,
RL   Berlin D-14195, Germany
XX
DR   MD5; f1d43207d9df3f090dc92e6e1d2ff593.
DR   Ensembl-Gn; ENSMUSG00000070425; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106943; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2869
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             57..2729
FT                   /codon_start=1
FT                   /product="transient receptor potential channel 2-beta"
FT                   /note="TRPC2-beta"
FT                   /db_xref="GOA:Q9R244"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002153"
FT                   /db_xref="InterPro:IPR002706"
FT                   /db_xref="InterPro:IPR005458"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013555"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:109527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R244"
FT                   /protein_id="AAG29951.1"
FT                   /translation="MDPLSPQPNWTEIVNKKLKFPPTLLRAIQEGQLGLVQQLLESSSD
FT                   ASGAGPGGPLRNVEESEDRSWREALNLAIRLGHEVITDVLLANVKFDFRQIHEALLVAV
FT                   DTNQPAVVRRLLARLEREKGRKVDTKSFSLAFFDSSIDGSRFAPGVTPLTLACQKDLYE
FT                   IAQLLMDQGHTIARPHPVSCACLECSNARRYDLLKFSLSRINTYRGIASRAHLSLASED
FT                   AMLAAFQLSRELRRLARKEPEFKPQYIALESLCQDYGFELLGMCRNQSEVTAVLNDLGE
FT                   DSETEPEAEGLGQAFEEGIPNLARLRLAVNYNQKQFVAHPICQQVLSSIWCGNLAGWRG
FT                   STTIWKLFVAFLIFLTMPFLCIGYWLAPKSRLGRLLKIPVLKFLLHSASYLWFLIFLLG
FT                   ESLVMETQLSTFKGRSQSVWETSLHMIWVTGFLWFECKEVWIEGLRSYLLDWWNFLDVV
FT                   ILSLYLASFALRLLLAGLAYMHCRDASDSTTCRYFTTAERSEWRTEDPQFLAEVLFAVT
FT                   SMLSFTRLAYILPAHESLGTLQISIGKMIDDMIRFMFILMIILTAFLCGLNNIYVPYQE
FT                   SEKLGNFNETFQFLFWTMFGMEEHTVVDMPQFLVPEFVGRAMYGIFTIVMVIVLLNMLI
FT                   AMITNSFQKIEDDADVEWKFARSKLYLSYFREGLTLPVPFNILPSPKAAFYLVRRIFRF
FT                   LCCGSSCCKAKKSDYPPIGTFTNPGARAGSAGEGERVSYRLRVIKALVQRYIETARREF
FT                   EETRRKDLGNRLTELTKTVSRLQSEVASVQKNLAAGGAPRPPDGASILSRYITRVRNSF
FT                   QNLGPPTSDTPAELTMPGIVETEVSLGDGLDGTGEAGAPAPGEPGSSSSAHVLVHREQE
FT                   AEGSGDLPLEGDLETKGES"
XX
SQ   Sequence 2869 BP; 579 A; 833 C; 787 G; 670 T; 0 other;
     agaggcagag ctggagttca agcattcagc ccctgcccac agaggtgggt gcagccatgg        60
     accccctttc gccacagccc aactggactg agattgtgaa caaaaagctc aaattccccc       120
     ccacactcct gcgtgccatc caggagggcc agctgggtct tgtgcagcag ctgctggaat       180
     ccagttccga tgcctcgggt gctgggccag gtggtcctct gcggaatgtg gaagagtctg       240
     aggaccgctc ctggagggaa gccctcaacc tggccatccg cctgggccac gaggtcatca       300
     ctgatgttct gctggccaat gtcaaattcg actttcggca gatccacgaa gccctgctag       360
     tggctgtgga cacaaaccag ccagcagtgg tgcgtcgcct gctagcgcgg ctggagcggg       420
     agaaaggtcg aaaagtagac accaagtctt tctctctagc cttctttgac tcatcgattg       480
     atggctcccg ctttgcccct ggtgtcactc cactcacact ggcctgccag aaggacctgt       540
     atgagattgc ccagctgctt atggaccagg gccataccat tgctcggccc cacccagttt       600
     cctgtgcctg cctcgagtgc agcaatgccc gccgatacga cctgctgaag ttctcactat       660
     cccgaatcaa cacctaccga ggcattgcaa gccgggctca cctctcgctg gccagtgagg       720
     atgccatgct ggccgctttt cagctcagcc gggagctcag gcgccttgca cgaaaggagc       780
     ctgagtttaa gcctcagtac attgccctgg agtctctctg ccaggactat ggcttcgagt       840
     tgctgggcat gtgccgaaat cagagtgagg tcaccgcagt gctcaatgac ctgggtgagg       900
     atagtgagac tgagcctgag gctgagggcc tgggtcaggc ctttgaggag ggcatcccca       960
     acctggcaag actgcggttg gctgtcaact acaaccagaa acagtttgta gcacatccca      1020
     tctgccagca agttctgtct tccatctggt gtgggaacct ggctggctgg cgtggaagca      1080
     ccaccatctg gaagctcttt gttgccttcc tcatcttcct caccatgccc ttcctctgca      1140
     ttggctactg gctggcgccc aagtcccggc tgggccgcct gctgaagatt ccggtgctga      1200
     agttcctgct gcattctgcc tcctacctgt ggttccttat cttcttgctg ggagagtctc      1260
     tggtcatgga gacccagctg agcaccttca aaggccgcag ccagagtgtc tgggagactt      1320
     cactacatat gatctgggtc acaggcttcc tatggtttga atgcaaggag gtgtggatcg      1380
     agggcttgcg gagctacctc ctggactggt ggaacttcct ggacgtggtc atcctgtccc      1440
     tgtacttggc atcctttgca ctgcgcctcc tcctggctgg gcttgcctac atgcactgcc      1500
     gtgatgcctc agacagcacc acctgccgct atttcaccac agctgagaga agtgagtggc      1560
     gtacagagga cccccagttt ctggctgagg tgctctttgc tgtcaccagc atgctcagct      1620
     tcacccgact ggcatatatt ctgccagctc acgaatcgct gggcacactg cagatctcca      1680
     tcggcaagat gattgacgac atgatccggt tcatgttcat cctcatgatc atcctgactg      1740
     ccttcctctg tggcctcaac aacatctatg tgccctacca ggaatccgag aagctaggca      1800
     atttcaacga aacgttccag tttctctttt ggaccatgtt cggcatggaa gagcacacag      1860
     tggtggacat gcctcagttc ctggtgcctg agttcgtggg cagggccatg tacggcatct      1920
     ttaccatcgt catggtcatt gtgctactta acatgcttat tgccatgatc accaactcct      1980
     tccagaagat cgaggatgat gctgatgtgg agtggaagtt tgctcgctcc aagctctacc      2040
     tgtcctactt ccgagagggt ctgacgctgc ctgtgccctt taacatcctg ccatccccaa      2100
     aggccgcctt ctacctcgtc aggagaattt tccggttcct ttgctgtggc tcctcctgct      2160
     gcaaagccaa gaagtcggac tacccgccca tcgggacctt taccaacccc ggggcaaggg      2220
     cgggctccgc cggggaagga gaacgcgtgt cctaccgcct tcgagtcatc aaggctctgg      2280
     tgcagcgcta catagagact gcccggcgcg agttcgagga gacccgtcgg aaagacctgg      2340
     gcaacagact gacagagctg accaagactg tgtctcgact gcaaagcgag gtggccagtg      2400
     tgcagaagaa cctggcggcg ggaggggcac cacggcctcc ggatggtgcc agcatcctca      2460
     gtagatacat cacccgagtg cgcaacagct tccagaacct gggcccccct acctctgaca      2520
     ccccagcaga gctgactatg cctgggattg tggagaccga agtctcttta ggagatggcc      2580
     ttgatggcac aggtgaagct ggagctcccg ctcctggaga gcccggctct tcctcctctg      2640
     ctcatgtgct ggttcacagg gagcaagaag cagaggggtc aggggacttg cccctggaag      2700
     gagatctgga gaccaagggc gagtcctaag gcaacagaag ggtctcttct gtcactaagt      2760
     gcagctgctg tgttgggtag agccagggtc tcacagtaga agaccatggt gctttttaat      2820
     attattatta tttattttat tttattttat ttgttttttt gcctcagta                  2869
//


spacer
spacer