Dbfetch

ID   AF230802; SV 1; linear; mRNA; STD; MUS; 3805 BP.
XX
AC   AF230802;
XX
DT   06-NOV-2000 (Rel. 65, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus transient receptor potential channel 2-alpha mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3805
RX   DOI; 10.1042/0264-6021:3510115.
RX   PUBMED; 10998353.
RA   Hofmann T., Schaefer M., Schultz G., Gudermann T.;
RT   "Cloning, expression and subcellular localization of two novel splice
RT   variants of mouse transient receptor potential channel 2";
RL   Biochem. J. 351(Pt 1):115-122(2000).
XX
RN   [2]
RP   1-3805
RA   Hofmann T., Schaefer M., Schultz G., Gudermann T.;
RT   ;
RL   Submitted (02-FEB-2000) to the INSDC.
RL   Institut fuer Pharmakologie, Freie Universitaet Berlin, Thielallee 67-73,
RL   Berlin D-14195, Germany
XX
DR   MD5; f1f4711daa06559e8ef7d8be687c740d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3805
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1005..3665
FT                   /codon_start=1
FT                   /product="transient receptor potential channel 2-alpha"
FT                   /note="TRPC2-alpha"
FT                   /db_xref="GOA:Q9R244"
FT                   /db_xref="InterPro:IPR002153"
FT                   /db_xref="InterPro:IPR002706"
FT                   /db_xref="InterPro:IPR005458"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013555"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="MGI:MGI:109527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R244"
FT                   /protein_id="AAG29950.1"
FT                   /translation="MPQPNWTEIVNKKLKFPPTLLRAIQEGQLGLVQQLLESSSDASGA
FT                   GPGGPLRNVEESEDRSWREALNLAIRLGHEVITDVLLANVKFDFRQIHEALLVAVDTNQ
FT                   PAVVRRLLARLEREKGRKVDTKSFSLAFFDSSIDGSRFAPGVTPLTLACQKDLYEIAQL
FT                   LMDQGHTIARPHPVSCACLECSNARRYDLLKFSLSRINTYRGIASRAHLSLASEDAMLA
FT                   AFQLSRELRRLARKEPEFKPQYIALESLCQDYGFELLGMCRNQSEVTAVLNDLGEDSET
FT                   EPEAEGLGQAFEEGIPNLARLRLAVNYNQKQFVAHPICQQVLSSIWCGNLAGWRGSTTI
FT                   WKLFVAFLIFLTMPFLCIGYWLAPKSRLGRLLKIPVLKFLLHSASYLWFLIFLLGESLV
FT                   METQLSTFKGRSQSVWETSLHMIWVTGFLWFECKEVWIEGLRSYLLDWWNFLDVVILSL
FT                   YLASFALRLLLAGLAYMHCRDASDSTTCRYFTTAERSEWRTEDPQFLAEVLFAVTSMLS
FT                   FTRLAYILPAHESLGTLQISIGKMIDDMIRFMFILMIILTAFLCGLNNIYVPYQESEKL
FT                   GNFNETFQFLFWTMFGMEEHTVVDMPQFLVPEFVGRAMYGIFTIVMVIVLLNMLIAMIT
FT                   NSFQKIEDDADVEWKFARSKLYLSYFREGLTLPVPFNILPSPKAAFYLVRRIFRFLCCG
FT                   SSCCKAKKSDYPPIGTFTNPGARAGSAGEGERVSYRLRVIKALVQRYIETARREFEETR
FT                   RKDLGNRLTELTKTVSRLQSEVASVQKNLAAGGAPRPPDGASILSRYITRVRNSFQNLG
FT                   PPTSDTPAELTMPGIVETEVSLGDGLDGTGEAGAPAPGEPGSSSSAHVLVHREQEAEGS
FT                   GDLPLEGDLETKGES"
XX
SQ   Sequence 3805 BP; 784 A; 1103 C; 1037 G; 881 T; 0 other;
     atcgacttcg attgacctgc tcccaacctt tcacacgtca tcagtccttt ggcctggcct        60
     tcctacgagt gcgttcctct ctgggctctc tggctgaccc tgtagtagat ccctcagccc       120
     ctgggagctc tgggcttaac cagaactcta cagatgtgct ggagtctgat cctaggccct       180
     ggctgactaa tccttctatc cggaggacat tcttccccga tccccagacg agcaccaagg       240
     aaatttcaga gctcaagggt atgttgaagc agttgcagcc agggcctctg gggcgggcag       300
     cccgcatggt gctttctgct gcccgtaagg cccctccagc cagtgtggta agcccaaaca       360
     acagccacgg agaaccaggt cccagccgtg cagagagtgc agagcccaga gcagaagaac       420
     caaacaggaa gacggctgtg ggcagaagga agaggaggaa agtgcaggag ccaaggagat       480
     cgttgtccaa ctcgagttct cagccaaata ggaggacagg aaggacaaga caaagacagc       540
     accgacctca gaccaaaagt gatgacggtg gtgtgcaggc tgctggacag tgtcctattt       600
     gtgcaggttt cttcagtatt gagactcttc cccagcatgc tgcaacttgt ggagagagcc       660
     ccccacccca gccagcttct cctgcctcct tgtcttcctc ggagtccgtg ctgtgggtct       720
     cctccccaga gagctcgccg ccaccttcct ggtcccagtg ccctatctgt gaattacagt       780
     tctcagcaag agaaatagaa gaacatgcca gcgtgtgtgg ggaagttttg ccagcctgag       840
     caatgacgtt ctgttgaccc tttatgttgg agcctgggga atggatctct ggtggctaag       900
     aagggctggg tcccctccct cccagtatta ctcaggactc cgcctgcctg agaacactgt       960
     ggacccagct tgctccccat tcctgttgtc aaggttttgt cactatgcca cagcccaact      1020
     ggactgagat tgtgaacaaa aagctcaaat tcccccccac actcctgcgt gccatccagg      1080
     agggccagct gggtcttgtg cagcagctgc tggaatccag ttccgatgcc tcgggtgctg      1140
     ggccaggtgg tcctctgcgg aatgtggaag agtctgagga ccgctcctgg agggaagccc      1200
     tcaacctggc catccgcctg ggccacgagg tcatcactga tgttctgctg gccaatgtca      1260
     aattcgactt tcggcagatc cacgaagccc tgctagtggc tgtggacaca aaccagccag      1320
     cagtggtgcg tcgcctgcta gcgcggctgg agcgggagaa aggtcgaaaa gtagacacca      1380
     agtctttctc tctagccttc tttgactcat cgattgatgg ctcccgcttt gcccctggtg      1440
     tcactccact cacactggcc tgccagaagg acctgtatga gattgcccag ctgcttatgg      1500
     accagggcca taccattgct cggccccacc cagtttcctg tgcctgcctc gagtgcagca      1560
     atgcccgccg atacgacctg ctgaagttct cactatcccg aatcaacacc taccgaggca      1620
     ttgcaagccg ggctcacctc tcgctggcca gtgaggatgc catgctggcc gcttttcagc      1680
     tcagccggga gctcaggcgc cttgcacgaa aggagcctga gtttaagcct cagtacattg      1740
     ccctggagtc tctctgccag gactatggct tcgagttgct gggcatgtgc cgaaatcaga      1800
     gtgaggtcac cgcagtgctc aatgacctgg gtgaggatag tgagactgag cctgaggctg      1860
     agggcctggg tcaggccttt gaggagggca tccccaacct ggcaagactg cggttggctg      1920
     tcaactacaa ccagaaacag tttgtagcac atcccatctg ccagcaagtt ctgtcttcca      1980
     tctggtgtgg gaacctggct ggctggcgtg gaagcaccac catctggaag ctctttgttg      2040
     ccttcctcat cttcctcacc atgcccttcc tctgcattgg ctactggctg gcgcccaagt      2100
     cccggctggg ccgcctgctg aagattccgg tgctgaagtt cctgctgcat tctgcctcct      2160
     acctgtggtt ccttatcttc ttgctgggag agtctctggt catggagacc cagctgagca      2220
     ccttcaaagg ccgcagccag agtgtctggg agacttcact acatatgatc tgggtcacag      2280
     gcttcctatg gtttgaatgc aaggaggtgt ggatcgaggg cttgcggagc tacctcctgg      2340
     actggtggaa cttcctggac gtggtcatcc tgtccctgta cttggcatcc tttgcactgc      2400
     gcctcctcct ggctgggctt gcctacatgc actgccgtga tgcctcagac agcaccacct      2460
     gccgctattt caccacagct gagagaagtg agtggcgtac agaggacccc cagtttctgg      2520
     ctgaggtgct ctttgctgtc accagcatgc tcagcttcac ccgactggca tatattctgc      2580
     cagctcacga atcgctgggc acactgcaga tctccatcgg caagatgatt gacgacatga      2640
     tccggttcat gttcatcctc atgatcatcc tgactgcctt cctctgtggc ctcaacaaca      2700
     tctatgtgcc ctaccaggaa tccgagaagc taggcaattt caacgaaacg ttccagtttc      2760
     tcttttggac catgttcggc atggaagagc acacagtggt ggacatgcct cagttcctgg      2820
     tgcctgagtt cgtgggcagg gccatgtacg gcatctttac catcgtcatg gtcattgtgc      2880
     tacttaacat gcttattgcc atgatcacca actccttcca gaagatcgag gatgatgctg      2940
     atgtggagtg gaagtttgct cgctccaagc tctacctgtc ctacttccga gagggtctga      3000
     cgctgcctgt gccctttaac atcctgccat ccccaaaggc cgccttctac ctcgtcagga      3060
     gaattttccg gttcctttgc tgtggctcct cctgctgcaa agccaagaag tcggactacc      3120
     cgcccatcgg gacctttacc aaccccgggg caagggcggg ctccgccggg gaaggagaac      3180
     gcgtgtccta ccgccttcga gtcatcaagg ctctggtgca gcgctacata gagactgccc      3240
     ggcgcgagtt cgaggagacc cgtcggaaag acctgggcaa cagactgaca gagctgacca      3300
     agactgtgtc tcgactgcaa agcgaggtgg ccagtgtgca gaagaacctg gcggcgggag      3360
     gggcaccacg gcctccggat ggtgccagca tcctcagtag atacatcacc cgagtgcgca      3420
     acagcttcca gaacctgggc ccccctacct ctgacacccc agcagagctg actatgcctg      3480
     ggattgtgga gaccgaagtc tctttaggag atggccttga tggcacaggt gaagctggag      3540
     ctcccgctcc tggagagccc ggctcttcct cctctgctca tgtgctggtt cacagggagc      3600
     aagaagcaga ggggtcaggg gacttgcccc tggaaggaga tctggagacc aagggcgagt      3660
     cctaaggcaa cagaagggtc tcttctgtca ctaagtgcag ctgctgtgtt gggtagagcc      3720
     agggtctcac agtagaagac catggtgctt tttaatatta ttattattta ttttatttta      3780
     ttttatttgt ttttttgcct cagta                                            3805
//