spacer

EBI Dbfetch

ID   AF228681; SV 1; linear; mRNA; STD; MUS; 3727 BP.
XX
AC   AF228681;
XX
DT   09-AUG-2000 (Rel. 64, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus MTR1 (Mtr1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3727
RX   DOI; 10.1006/geno.2000.6234.
RX   PUBMED; 10903843.
RA   Enklaar T., Esswein M., Oswald M., Hilbert K., Winterpacht A., Higgins M.,
RA   Zabel B., Prawitt D.;
RT   "Mtr1, a novel biallelically expressed gene in the center of the mouse
RT   distal chromosome 7 imprinting cluster, is a member of the Trp gene
RT   family";
RL   Genomics 67(2):179-187(2000).
XX
RN   [2]
RP   1-3727
RA   Enklaar T., Esswein M., Oswald M., Hilbert K., Winterpacht A., Zabel B.U.,
RA   Prawitt D.;
RT   ;
RL   Submitted (26-JAN-2000) to the INSDC.
RL   Pediatrics, University Children's Hospital, Langenbeckstr. 1, Mainz 55131,
RL   Germany
XX
DR   MD5; c9858cbed705ea04954b152e74f70898.
DR   Ensembl-Gn; ENSMUSG00000009246; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000150867; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3727
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   5'UTR           <1..87
FT                   /gene="Mtr1"
FT   CDS             88..3564
FT                   /codon_start=1
FT                   /gene="Mtr1"
FT                   /product="MTR1"
FT                   /note="MLSN1 and TRPC related protein"
FT                   /db_xref="GOA:Q9JJH7"
FT                   /db_xref="MGI:MGI:1861718"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJH7"
FT                   /protein_id="AAF98120.1"
FT                   /translation="MQTTQSSCPGSPPDTEDGWEPILCRGEINFGGSGKKRGKFVKVPS
FT                   SVAPSVLFELLLTEWHLPAPNLVVSLVGEERPLAMKSWLRDVLRKGLVKAAQSTGAWIL
FT                   TSALHVGLARHVGQAVRDHSLASTSTKIRVVAIGMASLDRILHRQLLDGVHQKEDTPIH
FT                   YPADEGNIQGPLCPLDSNLSHFILVESGALGSGNDGLTELQLSLEKHISQQRTGYGGTS
FT                   CIQIPVLCLLVNGDPNTLERISRAVEQAAPWLILAGSGGIADVLAALVSQPHLLVPQVA
FT                   EKQFREKFPSECFSWEAIVHWTELLQNIAAHPHLLTVYDFEQEGSEDLDTVILKALVKA
FT                   CKSHSQEAQDYLDELKLAVAWDRVDIAKSEIFNGDVEWKSCDLEEVMTDALVSNKPDFV
FT                   RLFVDSGADMAEFLTYGRLQQLYHSVSPKSLLFELLQRKHEEGRLTLAGLGAQQARELP
FT                   IGLPAFSLHEVSRVLKDFLHDACRGFYQDGRRMEERGPPKRPAGQKWLPDLSRKSEDPW
FT                   RDLFLWAVLQNRYEMATYFWAMGREGVAAALAACKIIKEMSHLEKEAEVARTMREAKYE
FT                   QLALDLFSECYGNSEDRAFALLVRRNHSWSRTTCLHLATEADAKAFFAHDGVQAFLTKI
FT                   WWGDMATGTPILRLLGAFTCPALIYTNLISFSEDAPQRMDLEDLQEPDSLDMEKSFLCS
FT                   RGGQLEKLTEAPRAPGDLGPQAAFLLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLL
FT                   VDFRPPPQGPSGSEVTLYFWVFTLVLEEIRQGFFTDEDTHLVKKFTLYVEDNWNKCDMV
FT                   AIFLFIVGVTCRMVPSVFEAGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKD
FT                   VFFFLFFLSVWLVAYGVTTQALLHPHDGRLEWIFRRVLYRPYLQIFGQIPLDEIDEARV
FT                   NCSLHPLLLESSASCPNLYANWLVILLLVTFLLVTNVLLMNLLIAMFSYTFQVVQGNAD
FT                   MFWKFQRYHLIVEYHGRPALAPPFILLSHLSLVLKQVFRKEAQHKRQHLERDLPDPLDQ
FT                   KIITWETVQKENFLSTMEKRRRDSEGEVLRKTAHRVDLIAKYIGGLREQEKRIKCLESQ
FT                   ANYCMLLLSSMTDTLAPGGTYSSSQNCGCRSQPASARDREYLESGLPPSDT"
FT   3'UTR           3565..>3727
FT                   /gene="Mtr1"
XX
SQ   Sequence 3727 BP; 823 A; 1039 C; 1044 G; 821 T; 0 other;
     aagcatcacg agcaacagcc ctgagcctca atttggaggc agtcctcatg cagtccaagg        60
     cactgactgc ctgactggaa agccaccatg caaacaaccc agagctcctg ccccggcagc       120
     cccccagata ctgaggatgg ctgggagccc atcctatgca ggggagagat caacttcgga       180
     gggtctggga agaagcgagg caagtttgtg aaggtgccaa gcagtgtggc cccctccgtg       240
     ctttttgaac tcctgctcac cgagtggcac ctgccagccc ccaacctggt ggtgtccctg       300
     gtgggtgagg aacgaccttt ggctatgaag tcgtggcttc gggatgtcct gcgcaagggg       360
     ctggtgaaag cagctcagag cacaggtgcc tggatcctga ccagtgccct ccacgtgggc       420
     ctggcccgcc atgttggaca agctgtacgt gatcactctc tggctagcac atccaccaag       480
     atccgtgtag tggccatcgg aatggcctct ctggatcgaa tccttcaccg tcaacttcta       540
     gatggtgtcc accaaaagga ggatactccc atccactacc cagcagatga gggcaacatt       600
     cagggacccc tctgccccct ggacagcaat ctctcccact tcatccttgt ggagtcaggc       660
     gcccttggga gtgggaacga cgggctgaca gagctgcagc tgagcctgga gaagcacatc       720
     tctcagcaga ggacaggtta tgggggcacc agctgcatcc agatacctgt cctttgcctg       780
     ttggtcaatg gtgaccccaa caccctagag aggatttcca gggcagtgga gcaggctgcc       840
     ccatggctga tcctggcagg ttctggtggc attgctgatg tactcgctgc cctggtgagc       900
     cagcctcatc tcctggtgcc ccaggtggct gagaagcagt tcagagagaa attccccagc       960
     gagtgtttct cttgggaagc cattgtacac tggacagagc tgttacagaa cattgctgca      1020
     cacccccacc tgctcacagt atatgacttc gagcaggagg gttcggagga cctggacact      1080
     gtcatcctca aggcacttgt gaaagcctgc aagagccaca gccaagaagc ccaagactac      1140
     ctagatgagc tcaagttagc agtggcctgg gatcgcgtgg acattgccaa gagtgaaatc      1200
     ttcaatgggg acgtggaatg gaagtcctgt gacttggaag aggtgatgac agatgccctc      1260
     gtgagcaaca agcctgactt tgtccgcctc tttgtggaca gcggtgctga catggccgag      1320
     ttcttgacct atgggcggct gcagcagctt taccattctg tgtcccccaa gagcctcctc      1380
     tttgaactgc tgcagcgtaa gcatgaggag ggtaggctga cactggccgg cctgggtgcc      1440
     cagcaggctc gggagctgcc cattggtctg cctgccttct cactccacga ggtctcccgc      1500
     gtactcaaag acttcctgca tgacgcctgc cgtggcttct accaggacgg gcgcaggatg      1560
     gaggagagag ggccacctaa gcggcccgca ggccagaagt ggctgccaga cctcagtagg      1620
     aagagtgaag acccttggag ggacctgttc ctctgggctg tgctgcagaa tcgttatgag      1680
     atggccacat acttctgggc catgggccgg gagggtgtgg ctgctgctct ggctgcctgc      1740
     aagatcataa aggaaatgtc ccacctggag aaagaggcag aggtggcccg caccatgcgt      1800
     gaggccaagt atgagcagct ggccctggat cttttctcag agtgctacgg caacagtgag      1860
     gaccgtgcct ttgccctgct ggtgcgaagg aaccacagct ggagcaggac cacgtgcctg      1920
     cacctggcca ctgaagctga tgccaaggcc ttctttgccc atgacggtgt gcaagcattc      1980
     ctgaccaaga tctggtgggg agacatggcc acaggcacac ccatcctacg gcttctgggt      2040
     gccttcacct gcccagccct catctacaca aacctcatct ccttcagtga ggatgccccg      2100
     cagaggatgg acctagaaga tctgcaggag ccagacagct tggatatgga aaagagcttc      2160
     ctatgcagcc ggggtggcca attggagaag ctaacagagg caccaagggc tccaggcgat      2220
     ctaggcccac aagctgcctt cctgctcaca aggtggagga agttctgggg cgctcctgtg      2280
     actgtgttcc tggggaatgt ggtcatgtac ttcgcattcc tcttcctgtt cacctatgtc      2340
     ctgctggtgg acttcaggcc accaccccag gggccgtctg gatccgaggt taccctctat      2400
     ttctgggtgt tcacactggt gctggaggaa atccgacagg gcttcttcac agatgaggac      2460
     acgcacctgg tgaagaaatt cactctgtat gtggaagaca actggaacaa gtgtgacatg      2520
     gtggccatct tcctgttcat tgtgggagtc acctgtagaa tggtgccctc ggtgtttgag      2580
     gctggcagga ccgttctggc cattgacttc atggtgttca cacttcggct catccacatc      2640
     tttgctattc acaagcagtt gggtcctaag atcatcattg tagagcgaat gatgaaggat      2700
     gtcttctttt tcctcttctt cctgagcgta tggcttgtgg cctatggtgt gaccactcag      2760
     gccctgctgc atccccatga tggccgtttg gagtggattt tccgccgtgt gctatacagg      2820
     ccttacctgc agatctttgg gcaaatccct ctggatgaaa ttgatgaggc tcgtgtgaac      2880
     tgttctcttc accctctgct gctggaaagc tcggcttcct gccctaatct ctatgccaac      2940
     tggctggtca ttctcctgct ggttaccttc ctgcttgtca ctaatgtgct gctcatgaac      3000
     cttctgatcg ccatgttcag ctacacattc caggtggtgc aaggcaatgc agacatgttc      3060
     tggaagtttc aacgctacca cctcatcgtt gaataccatg gaagaccagc tctggccccg      3120
     cccttcatcc tgctcagcca cctgagcctg gtgctcaagc aggtcttcag gaaggaagcc      3180
     cagcataagc gacaacatct ggagagagac ttgcctgacc ccttggacca gaagatcatt      3240
     acctgggaaa cggttcaaaa ggagaacttc ctgagtacca tggagaaacg gaggagggac      3300
     agcgaggggg aggtgctgag gaaaacggca cacagagtgg acttgattgc caaatacatc      3360
     ggggggctga gagagcaaga aaagaggatc aagtgtctgg aatcacaggc caactactgt      3420
     atgctcctct tgtcctctat gacggataca ctggctccag gaggcaccta ctcaagctct      3480
     cagaactgtg gttgcaggag tcagccagcc tctgctagag acagggagta cctagagtct      3540
     ggcttgccac cctctgacac ctgaaatgga gaaaccactt gctctagagc cccagacctg      3600
     gccacatcga gtttttgggg cacatcaacc ttcccccact cccagcagcc ccaagaaatg      3660
     gtcttcaagg ccttgctaca gatcacttct tggacatccc ttcctaagag aatgaaactc      3720
     atgtcag                                                                3727
//


spacer
spacer