Dbfetch

ID   AF227511; SV 1; linear; mRNA; STD; MUS; 2937 BP.
XX
AC   AF227511;
XX
DT   02-JAN-2001 (Rel. 66, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus adipocyte-derived leucine aminopeptidase mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2937
RA   Hattori A., Kitatani K., Matsumoto H., Mizutani S., Tsujimoto M.;
RT   "Molecular cloning of murine adipocyte-derived leucine aminopeptidase and
RT   its expression in adipocyte cell line, 3T3-L1 cells";
RL   Unpublished.
XX
RN   [2]
RP   1-2937
RA   Hattori A., Kitatani K., Matsumoto H., Mizutani S., Tsujimoto M.;
RT   ;
RL   Submitted (21-JAN-2000) to the INSDC.
RL   Laboratory of Cellular Biochemistry, The Institute of Physical and Chemical
RL   Research (RIKEN), 2-1, Hirosawa, Wako, Saitama 351-0198, Japan
XX
DR   MD5; ff71981790628a119cc32b877ab29b26.
DR   Ensembl-Gn; ENSMUSG00000021583; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020768; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020723; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020697; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020720; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020514; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021157; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020032; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020473; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020598; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020578; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020671; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020607; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021197; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019785; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020089; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000169114; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037610; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0037555; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0037522; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037572; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037327; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038030; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037282; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0037232; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0037378; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0037342; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0037496; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037338; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038085; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036916; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036727; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2937
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             52..2844
FT                   /codon_start=1
FT                   /product="adipocyte-derived leucine aminopeptidase"
FT                   /db_xref="GOA:Q9EQH2"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR033520"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="MGI:MGI:1933403"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQH2"
FT                   /protein_id="AAG44260.1"
FT                   /translation="MPSLLPLVLTFLSVSSPSWCQNSDIESLKASNGDSFPWNNMRLPE
FT                   YMTPIHYDLMIHANLSTLTFWGKTEVEIIASRPTSTIIMHSHHLQISKATLRRGAGEML
FT                   SEEPLKVLEYPAHEQVALLAAQPLLAGSLYTVIIDYAANLSESFHGFYKSTYRTQEGEM
FT                   RILAATQFEPTAARMAFPCFDEPALKASFSIKIKRDPRHLAISNMPLVKSVNVAEGLIE
FT                   DHFDITVKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEF
FT                   YEDYFNIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESSLLYDKEKSSASSKLGITMIV
FT                   SHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVTVTHPELKVEDYFFGKCFNAMEV
FT                   DALNSSHPVSTPVENPAQIREMFDDVSYEKGACILNMLRDYLSADTFKRGIVQYLQKYS
FT                   YKNTKNEDLWNSMMHICPTDGTQTMDGFCSRSQHSSSTSHWRQEVVDVKTMMNTWTLQK
FT                   GFPLITITVSGRNVHMKQEHYMNASERFPETGYLWHVPLTFITSKSDSVQRFLLKTKTD
FT                   VLILPEAVQWIKFNVGMNGYYIVHYADDGWASLSGLLKEAHTTISSNDRASLINNAFQL
FT                   VSIEKLSIEKALDLTLYLKNETEIMPIFQALNELIPMYKLMEKRDMIEVETQFKDFLLK
FT                   LLKDLIDKQTWTDEGSVSERMLRSQLLLLACVRNYQPCVQRAERYFREWKSSNGNMSIP
FT                   IDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFK
FT                   GEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQF
FT                   STRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL
FT                   "
XX
SQ   Sequence 2937 BP; 881 A; 611 C; 642 G; 803 T; 0 other;
     aatttgagca agaagatagt gtctctgctc ctcaaatagc cacttgcaag catgccctct        60
     cttcttcccc tagtattgac atttttatct gtgtcatctc cttcttggtg tcagaacagt       120
     gatatagaat ctctaaaagc tagtaatgga gactcattcc cttggaataa tatgcgactt       180
     cctgagtata tgaccccgat tcattatgat ctcatgatcc atgcaaacct cagcactctg       240
     actttctggg gaaaaacaga agtagaaatc atagctagcc ggcccaccag caccattatt       300
     atgcatagtc accacctgca aatatctaag gccaccctca gaagaggagc tggagagatg       360
     ctgtctgaag aaccactgaa ggtcctggaa tatcctgctc atgagcaagt tgcactgctg       420
     gctgcccagc cgcttcttgc tgggtccctg tacacagtta tcatcgacta tgctgccaac       480
     ctgtctgaga gtttccatgg attctataag agcacctaca gaacacagga aggtgaaatg       540
     agaatacttg cagcaacaca gtttgaaccc acagctgcta gaatggcttt tccctgcttt       600
     gatgaacctg ccctcaaggc aagtttttcc atcaagataa agagggatcc aaggcacctg       660
     gccatctcca acatgcccct ggtgaaatct gtgaatgttg ctgaaggact catagaagac       720
     cattttgaca tcactgtgaa gatgagtacc tacctagtgg ccttcatcat ttctgatttt       780
     aagtctgtga gcaagatgac taagagtgga gtcaaggttt ctgtgtatgc tgtgccagac       840
     aagataaatc aagccgatta tgctctggat gctgcagtga ctcttctaga gttttatgag       900
     gattatttca acattccata tcctttaccc aagcaagatc ttgctgcaat cccagacttt       960
     cagtctggtg ctatggaaaa ctggggactg accacataca gagagtcctc tctgttatac      1020
     gataaagaaa agtcttctgc atctagtaag cttggcatca caatgattgt gtcccatgaa      1080
     ctggctcacc agtggttcgg gaacctggtc accatggaat ggtggaatga cctttggctc      1140
     aatgaaggat ttgccaaatt tatggagttt gtgtctgtca ctgtgaccca tcctgaacta      1200
     aaagttgaag actatttctt tggcaagtgt tttaatgcaa tggaagttga tgcattaaac      1260
     tcctctcacc ctgtatccac acctgtggag aatcctgcgc agattcggga gatgtttgat      1320
     gatgtttctt atgaaaaggg agcttgtatt ctgaatatgc taagagatta tctgagtgca      1380
     gatacattta aaagaggaat tgtacagtat ctccaaaagt atagttataa aaacacaaaa      1440
     aacgaggacc tgtggaatag catgatgcat atttgcccta cagatggcac acaaacaatg      1500
     gatggcttct gctctagaag ccaacactca tcatcaacct cacactggcg tcaggaggtt      1560
     gtagatgtaa agaccatgat gaacacatgg acactgcaga agggctttcc tctgataacc      1620
     atcactgtga gtgggcggaa tgtgcacatg aagcaagaac actacatgaa cgcttcagaa      1680
     cgcttcccag agactgggta tttgtggcat gttccactga cattcattac cagcaaatca      1740
     gactcagtcc agagattttt gctgaagaca aagacagatg tgctcatcct cccagaagca      1800
     gtgcagtgga tcaaatttaa cgtgggaatg aatggctatt acattgtgca ttacgcggat      1860
     gatggatggg cttctctgag tggcctttta aaagaagcgc acacaacaat cagcagtaat      1920
     gatcgggcaa gtctcatcaa caatgcattt cagctggtca gcattgaaaa gttatcaata      1980
     gaaaaagccc tggatttaac cctgtacttg aaaaatgaaa ctgaaattat gcccatattc      2040
     caagctttga atgaactcat acctatgtat aagttaatgg agaaaagaga tatgattgag      2100
     gtggaaactc aatttaagga cttccttctc aagttgctga aggaccttat tgataagcag      2160
     acttggacag atgaaggctc tgtctcagag aggatgctca ggagccagct cctcctcctc      2220
     gcatgtgtgc gcaattatca gccctgtgtg cagagggcag agcgctattt cagagagtgg      2280
     aagtcatcta atggaaacat gagcatccct attgatgtga ccttggctgt gtttgctgtc      2340
     ggggcccaaa acacagaagg ctgggatttt ctttatagta aatatcagtc ttctttgtct      2400
     agtactgaga aaagccaaat tgaattttcc ctctgtacaa gcaaagatcc agaaaaactt      2460
     cagtggcttc tagatcaaag ttttaaggga gagataataa aaactcagga atttccacat      2520
     attctcacac tcattggcag aaacccagtg ggttatccat tggcctggaa gtttctgagg      2580
     gaaaattgga ataagcttgt acagaaattt gaacttggct catcgtccat agctcacatg      2640
     gtaatgggaa caacagacca gttttccacc agagcacgtc ttgaagaggt aaaaggattc      2700
     ttcagttcct tgaaagaaaa cggttctcag ctccgttgtg ttcaacaaac cattgagacc      2760
     attgaagaaa acatacgatg gatggataag aattttgata aaataagact gtggctgcaa      2820
     aaagaaaagc cagagttgct gtgacaatat gtttcttgcc aagttccaga atttatgatg      2880
     agcaaaattt tgttcaattt gagtattttt aaactaaaga tagttgtttt ggctact         2937
//