spacer

EBI Dbfetch

ID   AF226613; SV 1; linear; mRNA; STD; MUS; 2130 BP.
XX
AC   AF226613;
XX
DT   03-MAR-2000 (Rel. 62, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus ferroportin1 (Fpn1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2130
RX   DOI; 10.1038/35001596.
RX   PUBMED; 10693807.
RA   Donovan A., Brownlie A., Zhou Y., Shepard J., Pratt S.J., Moynihan J.,
RA   Paw B.H., Drejer A., Barut B., Zapata A., Law T.C., Brugnara C., Lux S.E.,
RA   Pinkus G.S., Pinkus J.L., Kingsley P.D., Palis J., Fleming M.D.,
RA   Andrews N.C., Zon L.I.;
RT   "Positional cloning of zebrafish ferroportin1 identifies a conserved
RT   vertebrate iron exporter";
RL   Nature 403(6771):776-781(2000).
XX
RN   [2]
RP   1-2130
RA   Donovan A., Brownlie A., Shepard J., Pratt S.J., Paw B.H., Barut B.,
RA   Zon L.I.;
RT   ;
RL   Submitted (20-JAN-2000) to the INSDC.
RL   Hematology/Oncology, Children's Hospital, 300 Longwood Ave., Boston, MA
RL   02115, USA
XX
DR   MD5; 7def1337e6dc772674b87b16a87741fc.
DR   Ensembl-Gn; ENSMUSG00000025993; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027137; mus_musculus.
DR   EuropePMC; PMC2838877; 20184753.
DR   RFAM; RF02253; IRE_II.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2130
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             298..2010
FT                   /codon_start=1
FT                   /gene="Fpn1"
FT                   /product="ferroportin1"
FT                   /note="transporter; Fpn1; iron exporter"
FT                   /db_xref="GOA:Q9JHI9"
FT                   /db_xref="InterPro:IPR009716"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="MGI:MGI:1315204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHI9"
FT                   /protein_id="AAF36696.1"
FT                   /translation="MTKARDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFA
FT                   VSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVI
FT                   LCGIILMMVFLHKNELLTMYHGWVLTVCYILIITIANIANLASTATAITIQRDWIVVVA
FT                   GENRSRLADMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFL
FT                   LWKVYQKTPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQE
FT                   PTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGS
FT                   ILSILMGASAITGIMGTVAFTWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLD
FT                   LSVSPFEDIRSRFVNVEPVSPTTKIPETVFTTEMHMSNMSNVHEMSTKPIPIVSVSLLF
FT                   AGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPE
FT                   AFGLLVLISVSFVAMGHLMYFRFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV"
XX
SQ   Sequence 2130 BP; 526 A; 497 C; 509 G; 598 T; 0 other;
     agagcaggct gggggtctcc tgcggccggt ggatcctcca acccgctccc ataaggcttt        60
     ggctttccaa cttcagctac agtgttagct aagtttggaa agaagacaaa aagaagaccc       120
     cgtgacagct ttgctgttgt tgtttgcctt agttgtcctt tggggtcttt cggcataagg       180
     ctgttgtgct tatactggtg ctatcttcgg ttcctctcac tcctgtgaac aagctcccgg       240
     gcaagagcag ctaaagctac cagcatcaga acaaacaagg ggagaacgcc tggtgtcatg       300
     accaaggcaa gagatcaaac ccatcaggaa ggatgctgtg gatccttagc aaactacctg       360
     acctcagcaa aattcctcct ctaccttggc cactctctct ccacttgggg ggatcggatg       420
     tggcactttg cagtgtctgt gtttctggtg gaactctatg gaaacagcct tctcttgaca       480
     gctgtctatg gactggtggt ggcaggctct gttctggtcc tgggagccat cattggtgac       540
     tgggtggata agaatgccag acttaaagtg gcccagacgt cactggtggt tcagaatgtg       600
     tccgtcatcc tctgcggaat catcctgatg atggttttcc tacacaagaa tgagctcctg       660
     accatgtacc atggatgggt ccttactgtc tgctacatcc tgatcatcac tattgcaaac       720
     attgcaaatt tggccagtac tgccactgcg atcacaatcc aaagggactg gattgttgtt       780
     gtggcaggag aaaacaggag cagattagca gacatgaatg ctaccattag aaggattgac       840
     cagctaacca acatcctggc ccccatggct gtcggccaga ttatgacatt tggttctcca       900
     gtcattggct gtggttttat ttccggttgg aatttggtgt ccatgtgtgt ggagtacttc       960
     ttgctctgga aggtttacca gaagacccct gctctggctg taaaagctgc tctcaaggta      1020
     gaggagtcag aactgaagca gctgacctca cctaaagata ctgagccaaa acctttggag      1080
     ggaactcatc taatgggtga gaaagactcc aacatccgtg aacttgaatg tgaacaagag      1140
     cccacctgtg cctcccagat ggcagagccc ttccgcactt tccgagatgg atgggtctcc      1200
     tactataacc agccagtgtt tctggctggc atgggcctgg ctttcctcta tatgacagtc      1260
     ctgggctttg actgtatcac tacagggtac gcctacactc aggggctgag tggatccatc      1320
     cttagtattt tgatgggagc atcagcaata actggaataa tgggaactgt ggccttcacc      1380
     tggctacgtc gaaaatgtgg ccttgttcgg actggtctat tctcaggact agcccagctt      1440
     tcctgtttaa tcttgtgtgt gatctccgta ttcatgcctg gaagcccctt ggacctgtct      1500
     gtttctccat ttgaagatat ccgttctagg tttgtgaatg tggagccagt gtccccaact      1560
     accaaaatac ctgagaccgt ctttacaaca gaaatgcata tgtccaacat gtctaatgtc      1620
     catgagatga gtactaaacc catccccata gtctctgtca gcctgctgtt tgcaggagtc      1680
     attgctgcta gaatcggtct ttggtccttt gatttgacgg tgacacagtt gctgcaagaa      1740
     aatgtaattg aatctgaaag aggcattatc aatggtgtgc agaactccat gaactacctt      1800
     cttgaccttc tgcatttcat catggtcatc ttggccccaa atcctgaagc ttttggcttg      1860
     ctggtattga tttcagtctc ctttgtggca atgggacatc ttatgtattt ccgatttgcc      1920
     cagaagactc tgggcaacca gatttttgtt tgtggtcctg atgaaaaaga agttacagat      1980
     gaaaatcaac cgaatacatc tgttgtataa aaatagttta gctgtggccc ctgttactag      2040
     attgtggaga gcatgtgtgc ttattttgta ctgcagaatc ccaataaatg cctgcatttc      2100
     tctccaaaaa aaaaaaaaaa aaaaaaaaaa                                       2130
//


spacer
spacer