spacer

EBI Dbfetch

ID   AF226605; SV 1; linear; mRNA; STD; MUS; 579 BP.
XX
AC   AF226605;
XX
DT   18-APR-2000 (Rel. 63, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus sigma 1 receptor beta variant mRNA, complete cds,
DE   alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-579
RA   Wang L.-M., Shelness G.S., Childers S.R., Mach R.H., Wheeler K.T.;
RT   "Sigma 1 beta receptor, an alternative splice variant of the sigma 1
RT   receptor";
RL   Unpublished.
XX
RN   [2]
RP   1-579
RA   Wang L.-M., Shelness G.S., Childers S.R., Mach R.H., Wheeler K.T.;
RT   ;
RL   Submitted (19-JAN-2000) to the INSDC.
RL   Radiology, Wake Forest University School of Medicine, Medical Center Blvd.,
RL   Winston-Salem, NC 27157, USA
XX
DR   MD5; 92a203ce58859f742284d3ccb3ee9e49.
DR   Ensembl-Gn; ENSMUSG00000036078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059354; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071561; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..579
FT                   /organism="Mus musculus"
FT                   /strain="Hej"
FT                   /mol_type="mRNA"
FT                   /tissue_type="breast"
FT                   /db_xref="taxon:10090"
FT   CDS             1..579
FT                   /codon_start=1
FT                   /product="sigma 1 receptor beta variant"
FT                   /note="no sigma 1 binding activity, strong sigma 2 binding
FT                   activity; CD region; alternatively spliced"
FT                   /db_xref="GOA:O55242"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="MGI:MGI:1195268"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55242"
FT                   /protein_id="AAF64281.1"
FT                   /translation="MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQL
FT                   ARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYV
FT                   LLFGTALGSHGHSGETVVHGPGEATALEWGPNTWMVEYGRGVIPSTLFFALADTFFGTQ
FT                   DYLTLFYTLRAYARGLRLELTTYLFGQDS"
XX
SQ   Sequence 579 BP; 97 A; 169 C; 180 G; 133 T; 0 other;
     atgccgtggg ccgcgggacg gcggtgggca tggatcaccc tgattctgac tattatcgca        60
     gtgctgatcc aggccgcctg gttgtggctg ggcactcaaa acttcgtctt ctctagagaa       120
     gaaatagcgc agcttgctcg acagtatgcg gggctggacc atgagcttgc cttctctcgg       180
     ctgatcgtgg agctgcggag gctgcaccca ggccacgtgc tgccggatga ggagctgcag       240
     tgggtatttg tgaacgcggg cggctggatg ggcgccatgt gtattctgca cgcctcgctg       300
     tctgagtacg tgctgctctt cggcaccgcc ctgggctccc atggccattc gggagagaca       360
     gttgtacacg ggcctggaga agcaacggct ctggagtggg gaccaaacac gtggatggtg       420
     gagtacggcc ggggtgttat tccgtctacc ctgttctttg cactagccga caccttcttc       480
     ggcacccagg actacctcac actcttctat acccttcggg cctatgcccg gggcctccgg       540
     cttgagctta ccacctacct ctttggccaa gactcctga                              579
//


spacer
spacer