spacer

EBI Dbfetch

ID   AF221507; SV 1; linear; mRNA; STD; MUS; 2356 BP.
XX
AC   AF221507;
XX
DT   16-FEB-2000 (Rel. 62, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus Lutheran glycoprotein (Lu) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2356
RA   Parsons S.F., Lee G., Chasis J.A., Tanner M.J.A., Anstee D.J.;
RT   "Mouse Lutheran glycoprotein";
RL   Unpublished.
XX
RN   [2]
RP   1-2356
RA   Parsons S.F., Lee G., Chasis J.A., Tanner M.J.A., Anstee D.J.;
RT   ;
RL   Submitted (06-JAN-2000) to the INSDC.
RL   Cell Adhesion Section, Bristol Institute for Transfusion Sciences,
RL   Southmead Road, Bristol BS10 5ND, UK
XX
DR   MD5; 29d116c6bb6bcd3238f7b361908c64f5.
DR   Ensembl-Gn; ENSMUSG00000002980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003061; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2356
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="IMAGE:466937"
FT                   /db_xref="taxon:10090"
FT   CDS             13..1881
FT                   /codon_start=1
FT                   /gene="Lu"
FT                   /product="Lutheran glycoprotein"
FT                   /db_xref="GOA:Q9R069"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1929940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R069"
FT                   /protein_id="AAF34657.1"
FT                   /translation="MEPPDARAGLLWLTFLLSGYSGAQAELHVSVPPRVEVMRGEQVAL
FT                   DCTPREHPEHYVLEWFLVDGTGARHRLASVEPQGSEFLGTVHSLGRVPPYEVDSRGRLV
FT                   IAKVQVGDGRDYVCVVKAGAAGTSEATSSVRVFATPEDTEVSPNKGTLSVMDQFAQEIA
FT                   TCSSNNGNPVPRITWYRNGQRLEVPMEVNQKGYITIRTVREASGLYSLTSTLYLRLHKD
FT                   DRDANFHCAAHYDLPSGQHGRLDSHTFRLTLHYPTEHVEFWVGSPSTTEGWVREGDAVQ
FT                   LLCQGDGSPSPEYSFFRQQGTQEEQLNVNLKGNLTLERVHRNQSGIYGCRVEDYDADEE
FT                   VQLVKKLKLHVAYLDPLELSVPEELFVFLNSSSTVVNCSARGLPTPTVRWTKDSVTLAD
FT                   GPMLSLQSVTFDSAGTYTCEASTPTVPLLSRTQSFQLIVQGAPELKPNEIMPKSGNSWT
FT                   EGDEVMLTCSARGFPEPKLTWSQRGDTPAEPPFEGRGWKSSSLMVKVTSALSREGVSCE
FT                   ASNIHGKKGHVFHFGSVAPQTAQAGVAVMAVAVSVGLLLLVVAAFYCMRRKGRPGCCRR
FT                   AEKGAPPAREPELSHSGSERPEHTGLLMGGPSGGGRGGSGGFGDEC"
XX
SQ   Sequence 2356 BP; 475 A; 715 C; 710 G; 456 T; 0 other;
     cacgagggga acatggaacc ccctgacgcc cgcgcagggc tgctgtggct caccttcctg        60
     ctgtcgggct actcaggtgc ccaggctgag ctgcacgtgt ccgtgccccc acgggtggag       120
     gtgatgcgag gcgagcaagt cgccctggac tgcactccac gggagcaccc tgagcattac       180
     gtgctggaat ggttcctcgt tgatggtact ggggctcgac accgtctggc ttctgtggaa       240
     ccacagggct cagagttcct gggcacagtc cactctctgg gccgcgtacc cccatacgag       300
     gtagactctc gtgggcgcct ggtgatagca aaggtccagg tgggcgatgg acgggactac       360
     gtgtgcgtag tgaaggctgg ggcagcgggt acctcagagg ccacctcaag tgtccgtgtg       420
     tttgcaacac cagaggatac ggaggtgtct cccaacaaag ggacgctgtc tgtgatggac       480
     cagtttgccc aggagattgc cacctgcagc agcaacaacg gaaaccccgt gcctcggatc       540
     acatggtacc gaaacgggca gcgtctggaa gtacccatgg aagtgaacca aaagggctac       600
     ataaccatcc gtactgtccg ggaagcctca ggcctgtact ccctgaccag caccctctac       660
     ctgaggctgc acaaggatga tcgggatgcc aacttccact gtgctgctca ctacgacttg       720
     ccctcaggcc aacatggccg cctggacagc catacctttc gcctcaccct gcactatccc       780
     acggaacatg tagaattctg ggtggggagc ccgtccacca cggagggctg ggtccgtgag       840
     ggtgatgctg tccagctgct ctgccagggc gatggcagcc ccagcccaga gtattctttt       900
     ttccgccagc agggtaccca ggaggaacag ctgaatgtca acctcaaggg aaacttgacc       960
     ctagaacggg tgcatcggaa ccagagcggg atctacggct gcagagtgga ggattacgat      1020
     gccgacgagg aagtgcaact tgtcaagaag ctaaagctgc acgtggccta cctggatcca      1080
     ttggagctga gcgtgcctga ggagctcttc gtattcctga acagcagcag cacggtggtg      1140
     aactgctccg ctagaggcct gcctactcct actgtgcgat ggaccaagga ttctgtgacc      1200
     cttgcagacg gccccatgct ctctctccag tctgtgacct ttgactcagc tggcacctat      1260
     acctgtgagg cgtccacacc cacagtcccc ctcctgagcc gcacacagag tttccagctc      1320
     atcgtccaag gagcaccaga gttaaaaccg aatgagataa tgcccaaatc agggaatagc      1380
     tggacagaag gcgatgaagt catgctgacc tgctccgccc ggggcttccc agagcccaaa      1440
     ctcacctgga gtcagcgagg cgatactcca gcagagccgc cctttgaggg tagaggctgg      1500
     aagagcagct cgctgatggt gaaagtgacc agcgccctga gccgagaggg cgtgtcctgt      1560
     gaagcgtcta acatccatgg caagaaaggc catgtcttcc actttggctc tgtggcccct      1620
     cagactgccc aggctggagt ggctgtcatg gctgtagctg tcagcgtcgg tcttttgcta      1680
     ctcgtggtcg ctgctttcta ttgcatgaga cgcaaagggc gccctggctg ctgccggcga      1740
     gcagagaaag gggcgccgcc agccagggaa ccggagttga gccactctgg gtcagagcgg      1800
     ccagaacaca cgggccttct catgggtggg ccctccggag gaggcagagg tggcagtgga      1860
     ggctttggag atgagtgttg aggctgacga cctcccagag gcaatctctg gatctggaac      1920
     tttgggcatc atcggaggac cggctctgag cacgcctccg cctcagcgca cgcctctgcc      1980
     tccttccttc tccagcctcg gccctccctt ccttcctctg cctgctgggc agggacccac      2040
     agtggccagc ggccttgggg agggaaagag ggaggtgggg gctgggaggg ggccttcctc      2100
     cagggaatgt aactctccca ggccccagaa tagctcctgg atccaagccc ggggcccggc      2160
     ctgggacacg gcgctgaggg tcggcaggct ggggctattt ttacctcctg actcccttgc      2220
     tgggcactac ccccccacct gataccctgc tgtgtagtct gacactggag tccccaaccc      2280
     accccattcc tgccctcatc ctcagcccat catttgtgaa cactggactc tgaaataaat      2340
     gctgcctgtc acgtgg                                                      2356
//


spacer
spacer