spacer

EBI Dbfetch

ID   AF218069; SV 1; linear; mRNA; STD; MUS; 1086 BP.
XX
AC   AF218069;
XX
DT   25-JAN-2000 (Rel. 62, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus galectin-8 (Lgals-8) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1086
RA   Maier C., Haeussler J., Roesch K., Moschgath E., Haeusler J., Vogel W.;
RT   "The human Lgals-8 gene: Genomic sequence and expression of the prostate
RT   carcinoma tumour antigen (PCTA-1) and the Po66 carbohydrate binding
RT   protein";
RL   Unpublished.
XX
RN   [2]
RP   1-1086
RA   Maier C., Haeussler J., Roesch K., Moschgath E., Haeusler J., Vogel W.;
RT   ;
RL   Submitted (21-DEC-1999) to the INSDC.
RL   Medizinische Genetik, Universitaet Ulm, Albert-Einsein-Allee 11, Ulm 89081,
RL   Germany
XX
DR   MD5; 6d7842be7b3c9c90742ed2fa5b2b2ebb.
DR   Ensembl-Gn; ENSMUSG00000057554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124888; mus_musculus.
DR   EuropePMC; PMC1166632; 15961541.
DR   EuropePMC; PMC196900; 12947044.
DR   EuropePMC; PMC64723; 11724951.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1086
FT                   /organism="Mus musculus"
FT                   /strain="C57Bl6/J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             116..1066
FT                   /codon_start=1
FT                   /gene="Lgals-8"
FT                   /product="galectin-8"
FT                   /note="galactose binding lectin"
FT                   /db_xref="GOA:Q9JL15"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:1928481"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JL15"
FT                   /protein_id="AAF27645.1"
FT                   /translation="MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERF
FT                   QVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEI
FT                   VFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSA
FT                   LGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKT
FT                   RDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAI
FT                   NGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW"
XX
SQ   Sequence 1086 BP; 331 A; 232 C; 260 G; 263 T; 0 other;
     ttactaccac cggggacaag tttttacttt gagtaatcct taaatgaaga gtgggtaaag        60
     tgtgtatacg gaagagagac tccaatcaac aatatcaata agttgaaaaa gaaaaatgtt       120
     gtccttaaat aacctacaaa atatcatcta taacccgata atcccctatg ttggcaccat       180
     tactgagcaa ttgaagcctg gctctctgat tgtaatccgt gggcatgtcc ctaaagattc       240
     agaaagattc caggttgact ttcagctggg caacagcctg aagccaagag cagacgtggc       300
     cttccacttt aaccctcggt tcaaaaggtc tagctgcatt gtttgtaaca cactgacaca       360
     ggagaagtgg ggctgggagg agatcaccta cgacatgccc ttcagaaaag aaaagtcctt       420
     tgagatcgtg ttcatggtgc tcaagaacaa attccaggtg gctgtgaacg gaaggcatgt       480
     tctgctgtac gcccacagga tcagcccgga gcagatcgac acagtgggca tctacggcaa       540
     agtgaacatc cactccatcg ggttcagatt cagctcggat ttacagagta tggaaacatc       600
     tgctctggga ctgacacaga taaacagaga gaatatacaa aagccaggca agctccagct       660
     gagcctgcca tttgaagcaa ggttgaatgc ctccatgggt cctggacgaa ccgttgtcat       720
     taaaggggaa gtgaacacca atgcccgaag ctttaatgtt gacctagtgg caggaaaaac       780
     aagggatatc gctctgcact tgaacccacg cctcaatgtg aaagcatttg taagaaattc       840
     ctttcttcag gatgcctggg gagaagagga gagaaatatt acctgcttcc catttagttc       900
     tgggatgtac tttgagatga taatctactg tgatgtccgg gaattcaagg ttgctataaa       960
     tggtgtgcac agcctggagt acaaacacag atttaaagac ctaagcagta ttgatacact      1020
     atcagtcgat ggtgatatcc gtttgctgga tgtaaggagc tggtagctac catgactgcc      1080
     aaaacc                                                                 1086
//


spacer
spacer