Dbfetch

ID   AF215892; SV 1; linear; mRNA; STD; MUS; 1032 BP.
XX
AC   AF215892;
XX
DT   22-JUN-2000 (Rel. 64, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus large conductance calcium-dependent potassium ion channel beta
DE   4 subunit mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1032
RX   PUBMED; 10804197.
RA   Weiger T.M., Holmqvist M.H., Levitan I.B., Clark F.T., Sprague S.,
RA   Huang W.J., Ge P., Wang C., Lawson D., Jurman M.E., Glucksmann M.A.,
RA   Silos-Santiago I., DiStefano P.S., Curtis R.;
RT   "A novel nervous system beta subunit that downregulates human large
RT   conductance calcium-dependent potassium channels";
RL   J. Neurosci. 20(10):3563-3570(2000).
XX
RN   [2]
RP   1-1032
RA   Holmqvist M.H., Weiger T.M., Levitan I.B.;
RT   ;
RL   Submitted (13-DEC-1999) to the INSDC.
RL   Department of Biochemistry, Volen Center for Complex Systems, Brandeis
RL   University, South Steet, Waltham, MA 02454, USA
XX
DR   MD5; 88e52b61e38fcbd9f9a5614e9fa1561a.
DR   Ensembl-Gn; ENSMUSG00000054934; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068233; mus_musculus.
DR   EuropePMC; PMC1304156; 15111404.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1032
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="9-11 weeks"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             3..635
FT                   /codon_start=1
FT                   /product="large conductance calcium-dependent potassium ion
FT                   channel beta 4 subunit"
FT                   /note="SLO; SLOWPOKE; MAXIK"
FT                   /db_xref="GOA:Q9JIN6"
FT                   /db_xref="InterPro:IPR003930"
FT                   /db_xref="MGI:MGI:1913272"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JIN6"
FT                   /protein_id="AAF75597.1"
FT                   /translation="MAKLRVSYEYTEAEDKSIRLGLFLIVSGILSLFIFGFCWLSPALQ
FT                   DLQATAANCTVLSVQQIGEVFECTFTCGTDCRGTSQYPCVQVYVNNSESNSRALLHSDQ
FT                   HQLLTNPKCSYIPPCKRENQKNSESVMNWQQYWKDEIGSQPFTCYFNQHQRPEDVLLQR
FT                   THDEIALLHCFLWPVVAFVVGVLIVVLTICAKSLAVKAEAMKKRKFS"
XX
SQ   Sequence 1032 BP; 257 A; 276 C; 280 G; 219 T; 0 other;
     cgatggcgaa gctcagggtg tcttacgagt acacggaagc cgaagacaag agcatccggc        60
     tcggcttgtt cctcatcgtc tccggcatcc tgtcgctctt catcttcggc ttctgctggc       120
     tcagtcccgc cttgcaggat ctgcaagcca cggcggccaa ctgcaccgtg ctgtcggtgc       180
     agcagatcgg cgaggtgttc gagtgcacct tcacctgtgg caccgactgc aggggcacct       240
     cgcagtatcc ctgcgtccag gtgtacgtga acaactccga gtccaactcc agggcgctgc       300
     tacacagcga ccagcaccag ctcctgacca accccaagtg ctcctatatc ccgccctgta       360
     agagagaaaa ccagaagaac tcggagagcg tcatgaactg gcagcagtat tggaaagatg       420
     agatcggttc ccagccattc acttgctatt ttaatcagca tcagagacca gaggacgttc       480
     tcctacagcg cacacacgac gagattgctc tcctgcactg cttcctctgg ccggtggtgg       540
     cgtttgtggt gggtgttctc atcgtggtcc tgaccatctg tgccaagagc ctggcggtca       600
     aggcggaagc catgaagaaa cgcaagttct cttaacgggg aggaggagga ttgtgggaag       660
     ccgagaccag aggttgcctc gtcggcactc gcctgccctg cagagcccac atttggtggc       720
     gcaggagatg gaaggggccg caagaggccc ccgagaggcc cctccctcgt cggcagcaga       780
     aacaggcaca gttggaagac tggggggact taactgcctg tattccatgt gctgtagcaa       840
     cggctaaagg gtcaagctct tagctctatg gagtgactaa ctgtttggga aaccctcaaa       900
     gaagtcggtt ttctttggaa agtaacagtc tatcatttgt atagtgtagt atacaaacca       960
     ttatgattta tgctcctcac aaatattaaa agacagtgct ctgtgaaaaa aaaaaaaaaa      1020
     aaaaaaaaaa aa                                                          1032
//