Dbfetch

ID   AF215668; SV 1; linear; mRNA; STD; MUS; 737 BP.
XX
AC   AF215668;
XX
DT   16-FEB-2000 (Rel. 62, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus regulator of G-protein signaling 2 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-737
RX   PUBMED; 10779778.
RA   Reif K., Cyster J.G.;
RT   "RGS molecule expression in murine B lymphocytes and ability to
RT   down-regulate chemotaxis to lymphoid chemokines";
RL   J. Immunol. 164(9):4720-4729(2000).
XX
RN   [2]
RP   1-737
RA   Reif K., Cyster J.G.;
RT   ;
RL   Submitted (14-DEC-1999) to the INSDC.
RL   Microbiology and Immunology, University of California San Francisco, 513
RL   Parnassus Avenue, San Francisco, CA 94143-0414, USA
XX
DR   MD5; f01cc6f7b536f3d6deeb109f88c5318a.
DR   Ensembl-Gn; ENSMUSG00000026360; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016565; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016548; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016513; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016508; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016333; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016969; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015912; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016307; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016413; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016411; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016484; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016437; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017005; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015698; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015975; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000127206; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0022514; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0022483; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0022450; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0022453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0022263; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0022966; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0021791; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0022203; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0022327; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0022338; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0022429; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0022306; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0023003; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0021513; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0021832; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..737
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="12.5 dpc total fetus"
FT                   /tissue_type="embryo"
FT                   /db_xref="taxon:10090"
FT   CDS             17..652
FT                   /codon_start=1
FT                   /product="regulator of G-protein signaling 2"
FT                   /note="RGS2; GTPase activating protein for G-alpha
FT                   subunits"
FT                   /db_xref="GOA:O08849"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR034947"
FT                   /db_xref="MGI:MGI:1098271"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08849"
FT                   /protein_id="AAF34625.1"
FT                   /translation="MQSAMFLAVQHDCVPMDKSAGNGPKVEEKREKMKRTLLKDWKTRL
FT                   SYFLQNSSAPGKPKTGKKSKQQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAFLKSE
FT                   FCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKSLIAQNIQ
FT                   EATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHAT"
XX
SQ   Sequence 737 BP; 240 A; 177 C; 171 G; 149 T; 0 other;
     gcgcgggagt ctgagaatgc aaagtgccat gttcctggct gtccagcacg actgcgtacc        60
     catggacaag agtgcaggca acggccccaa ggtcgaggag aagcgggaga aaatgaagcg       120
     gacactctta aaggattgga agacccgttt gagctacttc ttgcagaatt cctctgctcc       180
     tgggaagccc aaaactggca agaaaagcaa acagcaaact tttatcaagc cttctcctga       240
     ggaagcgcag ctctgggcag aagcatttga tgaactgctg gccagtaaat atgggctggc       300
     tgcattcagg gcgtttttaa agtccgagtt ctgtgaagaa aacattgaat tctggttggc       360
     ttgtgaagac ttcaaaaaaa ccaaatcacc ccaaaaactg tcctcaaaag caaggaaaat       420
     ctataccgac ttcatagaga aggaagctcc caaagagata aacatagact tccaaacgaa       480
     atctctgatt gcccaaaata tccaagaggc tacaagtggc tgcttcacca cagctcagaa       540
     gagggtgtac agtttgatgg agaacaattc ttatcctcgg ttcttggagt ccgaattcta       600
     ccaggactta tgtaaaaagc cacagatcac cacggagccc catgctacat gagaccagga       660
     gtccccccac acacaaagga cattccattc tgtctcccaa gagcaaaggc tgtgacctgc       720
     cagaaaaaaa aaaaaaa                                                      737
//